KEGG   Columba livia (rock pigeon): 102084453Help
Entry
102084453         CDS       T02912                                 

Gene name
KMT2A
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 2A
  KO
K09186  histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102084453 (KMT2A)
Enzymes [BR:clv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102084453 (KMT2A)
Transcription factors [BR:clv03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    102084453 (KMT2A)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102084453 (KMT2A)
   HMT complexes
    MLL-HCF complex
     102084453 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET FYRC FYRN PHD zf-CXXC zf-HC5HC2H zf-HC5HC2H_2 PHD_2 Bromodomain PHD_4
Motif
Other DBs
NCBI-GeneID: 102084453
NCBI-ProteinID: XP_021140843
LinkDB All DBs
Position
Unknown
AA seq 3870 aa AA seqDB search
MLPGERRSSGILSCFDHGEVRFRVNIHIFKFLPPLSLQDEQFLGFGSDEEVKVRSPTRSP
TVKSSPRKPRGRPRSSSDRSSAVLSDSSSVCSPSSKSESTSMEKVKKKELKSGEKRRGRP
PTLTSVKFKLSQVKDASDVQKGSKEEKESVKKIKRSPSTTFQQATKIKKLRTSKLSPLKS
KFKPGAKLQIXXXXXGRPPSSERVKTPSALVVNSQLEKPQRMRKEKDGTPPLTKEEKTAV
RQSPRRIKPVRIIPSTKRTDATIAKQLLQRAKKGAQKKIEKEAAKLQGRKGRTQLKNIRQ
FIMPVVSAISSRIIKTPKRFIEDEDYDPPIKISRLESTPNSRFSATSCGSSEKSSAASQH
SSQMSSDSSRSSSPSVDTSTDSQASEEVQTPSEERSNTPEVHAPLPVSQSPENDNGDRRN
RRFSVTERSFSQRTAKKLPALPSVPQQPSPSPPPPLPPPPPPLQPASSISDHTPWLMPPT
IPLASPFLPASAAPMQEKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFD
NFRPPPLTPEDVGFASGFSTPGATAPARLFSLHSGTRFDMHKRSPLLRAPRFTPSEAHSR
IFESVILPSSVGRSAAGTSAAGVSSRKRKRRVFSPIRSEPRSPSHSMRTRSGRLSTSDLA
TLAPQSSVSSSLTSISVSSLATSALNSTFTFPSHSLTQSGESAERSQRPRKQTSTPAEPF
SSSSPAPLFPWFTSSPQTERGRNKDRAAEELSKDKDADKSLEKDKSREKDREREKENKRE
SRKEKRRKGSEVQSSSALFPVGKTPKEKVVSEDVAASSSAKKPAGRKKSTAIDPAADVST
AALGDAAAGKTKTSKKGRGGLDKSDLDLSPTVPSAEKEKALRLSAPSSSTVKHSTSSISS
MLAQADKLPMTDKRVASLLKKAKAQLYKIEKSKSLKQADQPKAQGQESDSSETSVRGPRI
KHVCRRAAVALGRKRAVFPDDMPTLTMCAYIYVQAHAHRSCGSAGELRRSGIYSISKLDA
SFAMSGFTLAISLIDKSSIAGSEEAEPLAPPIKPIKPVTRNKAQQEPPVKKGRRSRRCGQ
CSGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAAKKKE
KKSKTNEKKESHSGKNQLDSGQKQTPQAVIAREDAAVKKSSEPARKPVEEKHEDGNPSGP
VPEPKQVPAAGTRKTSAPLKKEAPTPAASEPKKKQTPQPEIGTEQSKQKKIAPRPTFPVK
QKPKDKEKPPPISKPESSTLNLLSTLTNGSSSKQKPPPDGVHRIRVDFKEDCEVENVWEM
GGLGIVTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEESERPLEDQLENWCCR
RCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWICTKCVRCKSCG
STTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQCGKCDRWVHS
KCENLSDEMYEILSNLPESVAYTCINCTEQHPAEWRLALEKELQVSLRQXAXXXXXPSHL
LRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQEEQQPLDLEGVKRKMDQAGY
TSVLDFSDDIVKIIQAAINSDGGQPEVKKANSMVKSFFIRQMERVFPWFSVKKSRFWEPN
KVTSNSGMLPNAVLPPSLDHNYAQWQXXXXXXXXXXXXXPKPKGPGEPDSPTPLHPPTPP
ISSSDRSREDSPELNPPPDVEDNRQCALCLKYGDDSANDAGRLLYIGQNEWTHVNCALWS
AEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKSGATVGCCLTSCTSNYHFMCSRAKNCVFL
DDKKVYCQRHRDLIKGEVVPENGFEVLRRVFVDFEGISLRRKFLSGLEPENIHMMIGSMT
IDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKRCVYTCKIMECRPPVIEPDINSTV
EHDDNRTIAHSPVPLTESLPKDSRNAPEIVSPPSPDRPLHSQTSGSCYLPGGSKAPRLRA
PSYPSAQRSPGSRPLPSAGSPTPVTHEIVTVGDPLLSSGLKSIGSRRHSTSSLSQQQSKL
RMISPPRAGSAYSRHSVSSVPSAGTSAEHEPSGKSTDRFAGPANAGAPSAPGQSCSASSG
AQKIAAASGSKTYQLDLSQSAEGKHSSSSDLVAKAVASKGEKMKTSKDPDYLAHSFASGG
NSKVSAQLTSSSGTEINVKIGTFQECSGSFSSKEAISFPPLHQRGPRKDRDQHVEPAAQP
EKTTVVDEVDAKTLKAAGVNSRSPAASEPVASAPRDRRQKGKKLMKDSFKEKLSLKSLTD
SSQAVGGDEGNLKLEFGNQGLATEQISQRLCNNIPAEKAGEKSPPSQGQPKGSAGQSDVA
SKEPQAPRKRTVKVTLTPLKMESESQAKSAQQEGDVDPQSAGAEPAALAEPSSASESPEG
NAAAQGSPSEAPAQESQSNAYENLPIQDNNLMLQDGTKAPEEGSYKRRYPRRSARARSNM
FFGLTPLYGVRSYGEEDIPFYSNSTGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRT
VVSSNAEERLASHSLFREEEQCDLPKISQLDGVDDGTESDTSVTATTRKVSQVTKRSSKE
NGTENLKLDRTEEASEKVQVTKSSAVHKSDPKMDNCHPVSRVKAQGQDSLEAQLSSLETG
RRAHASTPSDKNLLDTFNTELLKSDSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESP
ESSSSELLTLGEGLGLDSNRGKDMGLFEVFSQQLPTAEPVDSSVSSSISAEEQFELPLEL
PSDLSVLTTRSPTVPSQNHNRLAVISESSLSSSGERSMLALPSAESGEKRVTVTEKSTSG
EGDAALLSPGVDPSPEGHMTPDHFIQGHMDAEHIASPPCGPVEQGHGGNQDLTRNSGTPG
IPVSPTVPLQSQKYVPNSTDSPGPSQISNAAVQTTPPHLKPAAEKLLVVNQNMQPLYVLQ
TLPNGVTQKIQLTPSVSSAQSVMESGASVLGPMGSGLTLATGLNPSLPSSQSLFPPASKG
LLPMPHHQHIHPFSTGSPSPGLLIGVQPPPDPQLLVSEASQRTDLGTTSAPAAALGKKRP
ISRLHSRKNKKLAPSGTPPAIAPPDMVSNMTLINFAPSQISNHPLDLGSIANSTSHRTVP
NIIKRSKSGVMYFEQTSLLPQGGTSAAVGTSPSVIGPDAGHLPAGPVSGLASSSSVLNVV
SMQATAAPTTGGSVPGHVLGQSSVTLTSPGLLGDLGSISNLLIKASQQSLGLQDQHMTLP
PSSGMFSQLGASQTPSTAAMTAASSICVLPSAQSMGMTVAPSSADPEGSYQLQHMTQLLA
SKTGVASSPLDLGTASAAPQLSSFPQLVDVPNSTGLEQTKASSAAMHASSASPGGSPSSA
QHSASGSVLGPAKTKLKVKRIQPSLDKGNGKKHKMSHLWASSSEAHVPDRGAVAGPQVSA
TGAPAAKADAQDAAGVDQPSQQQCGQSAGQTAALPEPQSPQNPAREQENAGSKALEEEES
TFSSPLMFWLQQEQKXXXXXLGEKKPKKGLVFEISSDDGFQICAESIEDAWKSLTDKVQE
ARSNARLKQLSFAGVNGLRMLGIIHDTVVFLVEQLYGAKHCRNYKFRFHKPEEANEPPLN
PHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKSARRATSMDLPMPMR
FRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYSGNVIRSILTDKREKYYDSKG
IGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKHIVIFAMRKIYRGEE
LTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 11613 nt NT seq  +upstreamnt  +downstreamnt
atgttacctggggagcgaagatcctccggaatcctttcatgctttgatcacggtgaagtt
cgttttcgtgttaatatccacatcttcaaatttctaccccctttgtcattgcaggatgaa
cagtttttaggttttggttcagatgaagaagtcaaagtacgaagtcccaccaggtccccc
acagttaaatcgagcccacggaagcctcgcgggaggccccggagcagttctgaccgaagt
tcagctgtactgtcagactcctcgtcagtgtgttccccttcgagcaagtctgaaagcaca
tccatggagaaagtaaagaagaaggagttgaagagcggggaaaaaaggcgaggaagacct
ccaacgctgacgagcgtgaagttcaagctgtcacaagtaaaggacgcgtcggacgttcag
aagggcagtaaagaagaaaaggagagtgtgaaaaaaatcaaaaggtcaccatccactacg
tttcagcaagcaactaaaatcaagaagttaagaactagtaagctctccccactgaaatcc
aaatttaagcctggggcaaaacttcagattnnnnnnnnnnnnnnaggcaggccgccgtcc
tccgaacgcgtcaagactccctccgccttggtcgtaaactcgcagctggagaagccccag
aggatgcgcaaagaaaaggatggcacgccacccctcacgaaggaagagaagactgctgtc
aggcagagcccgcgcaggatcaagcccgttcgcattataccttccaccaaaaggacggac
gccacgatcgccaagcagctcttgcagagggcgaaaaaaggggcgcaaaaaaagattgag
aaagaagcagccaaactgcagggcaggaaggggagaacccagctcaaaaacatccggcag
ttcattatgccggttgtgagcgcgatctcttcacggattattaaaacacccaaacggttc
attgaggacgaagactacgatcctcctattaaaatatccagactggaatccacaccgaac
agccggttcagcgctacatcttgtggctccagcgagaagtccagcgctgcttctcagcat
tcgtctcagatgtcgtcagactcctcgcggtccagcagccccagcgtggacacgtccaca
gactcccaggcttccgaggaggtgcagacgccttctgaagagcggagcaatactccggaa
gttcacgcgccgctgcccgtttctcagtcccctgaaaatgataacggcgataggaggaac
aggaggttttcggtaacggaaaggagtttcagccaaaggaccgcgaagaagctgccagcc
ttaccgagcgtgccgcagcagccctcgccctccccccccccccctctgcccccccccccg
ccgccgctgcagcccgcgtccagcatctcggaccataccccctggctcatgccgcccacc
atcccgctggcctcgcccttccttcccgcctctgccgcgcccatgcaggagaagcgcaag
tcgatcctgcgggagcccacgttccgctggacctccctgaagcattccaggtcagaaccg
cagtacttctcctctgcaaagtatgccaaagaggggctgatccgcaagccgatattcgat
aacttcaggcccccgccgctgacgccggaggacgtcggctttgcatccggcttctcgacg
ccaggcgcgacggctccagcgcgcctgttttctctccactcgggaacgcggttcgacatg
cacaagaggagccctctactgagagcgccgcggttcacgccgagcgaggcccactccagg
atcttcgagtctgtgattctgccctcgtcggttggccgcagcgccgcagggacctccgcg
gcgggcgtctcctcgcggaagcggaagaggagagtattcagccccatccgctcggaaccc
agatctccctcgcactccatgaggacgagaagcgggaggctcagtacctcggacctggcg
actctcgccccgcagtcttctgtctcttcctccttaactagcatttctgttagttctctt
gccactagtgccttaaactcaacttttacttttccttcccattccctgacgcagtctggg
gagtcggcggaaagaagccagcggccgaggaagcagaccagcactccggcagagcctttc
tcgtccagcagccctgctcctctcttcccctggttcacgtcgagcccccagacagagcga
ggcagaaacaaggacagggcagcagaggagctctccaaagataaagacgctgacaaaagc
ctggagaaggacaagagcagagagaaagacagagagagagaaaaggagaacaagcgggag
tcaaggaaggagaaaaggagaaaagggtcggaagttcagagtagctcggctctgttccca
gtaggtaaaacgcccaaagaaaaagttgtcagcgaagatgtcgcagcatcgtcatctgcc
aaaaaacctgctgggcggaagaagtccacagcaatagatcccgcggcagacgtttccacc
gccgctctgggagacgcggcagccggcaaaaccaaaacgtccaagaagggcagagggggg
ttagacaaatcggatctggacctcagccccaccgtgccgtctgcggagaaggaaaaagcc
ctgcgtctctctgctccttcctcaagcactgttaaacattccacgtcctccatcagctcc
atgttggctcaggcagacaaactgcccatgactgacaagagagtggccagtcttctgaaa
aaggcaaaagcccagctgtacaaaatcgagaagagcaagtccctcaaacaggctgatcag
ccaaaagcacagggacaagagagcgattcgtcagaaacgtcagtgcgaggaccacgcatc
aaacacgtttgcaggagagcagctgtcgcgctgggccgcaagcgggcggtgtttcctgat
gacatgcccactctgactatgtgtgcgtacatatacgtacaggctcacgcgcaccgctcg
tgtggctctgcaggtgaactgaggcgtagtggaatatattccattagcaaactggacgca
tcttttgccatgagtgggttcacactggcaatttctttgatagataagtcatcgatagct
ggctcagaagaggccgaacctctggctccaccgatcaagccgataaagccggtcaccaga
aacaaggcgcagcaggaaccgccggtgaagaagggccggcgctcgcggcgctgcgggcag
tgttcgggctgccaggttccagaggactgtggagtctgcaccaactgcctggacaagccc
aagttcggtgggcgcaatataaagaagcagtgctgcaagatgaggaagtgtcagaatctg
cagtggatgccttccaaagcgtacctgcagaagcaagctaaagctgcaaaaaagaaagag
aagaaatcgaagacaaacgagaagaaagaaagccattctggaaagaaccagttggactcc
gggcagaaacaaactcctcaggccgtcatagcgagagaagacgctgctgtgaagaagagc
agcgagcctgcccgcaagcccgttgaggagaagcacgaggacgggaatccctccggcccg
gtgccggagcccaaacaggtccctgcggccggcaccaggaagacctccgcacctctgaaa
aaagaagcccccacccctgccgcttctgagcctaagaaaaagcagactccccagccagaa
ataggcacagaacaaagcaaacagaaaaaaattgctccccgtccaactttccctgtgaaa
cagaaaccaaaagacaaggaaaagccccctcccataagcaagcccgaaagcagcacgctg
aacttgctcagcactctgactaatggcagcagttccaagcaaaagccacccccagatgga
gtccacagaatccgagtggatttcaaggaggactgtgaagtggagaatgtttgggagatg
ggtgggttaggcatcgtcacctcggtacctattactcccagggtggtctgttttctctgt
gccagcagtggacacgtggagttcgtgtactgtcaggtctgttgtgagccctttcacaag
ttctgcctggaggagagcgagcggccgctggaggaccagctggagaactggtgctgccgt
cgctgcaagttctgccacgtgtgtgggagacagcaccaggccaccaagcagctgctggag
tgtaacaagtgccgaaacagctatcaccccgagtgcctgggcccaaactacccgacaaag
cccaccaagaagaagaaagtttggatatgtaccaaatgtgttcgctgcaagagctgcgga
tccacgacaccaggcaaagggtgggatgcgcagtggtctcacgacttctcgctgtgccac
gattgtgccaaactctttgcgaaaggaaacttctgtcctctctgtgacaagtgctacgac
gatgacgactacgagagcaagatgatgcaatgcgggaaatgcgaccgctgggtccactcc
aagtgtgaaaacctttctgatgagatgtatgagatactctctaacttgccggagagcgta
gcgtacacctgcattaactgcacggagcagcatcctgcggagtggcgcctggcgctggag
aaggagctgcaggtgtccctgcggcagngggcgnnnnnnnnnnnnnnncccagccacttg
ctgcggtatcgacaggcagcaaaaccgcctgatttaaaccccgagacggaggagagtatc
ccatcccgaagctcgccagaaggtcctgacccccccgtcctaaccgaagtcagcaagcag
gaggagcagcagcctctggatctggaaggagtgaagaggaaaatggatcaagcaggttac
acctctgtgttggattttagtgatgatatcgtgaagataattcaagcagccatcaattcc
gacggcgggcagccggaggtgaagaaagccaacagcatggtcaagtccttctttattcgg
caaatggagcgtgtttttccatggttcagtgtaaaaaagtccagattttgggagccaaat
aaagtaacgagcaacagtggtatgttgccgaacgcggtgctgcccccttcgcttgaccat
aactatgctcagtggcaggnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnntcca
aaacccaaagggcccggagagccggattccccaacccctctgcatcctcctacaccgcca
atctccagctctgaccgaagcagagaggatagtcctgaactgaacccacctccagacgtg
gaagacaacaggcagtgcgcgttgtgcctgaaatacggtgacgacagcgctaacgatgct
ggacgtcttctgtatatcggccagaatgaatggacacacgtgaactgtgctttgtggtcg
gcagaggtgtttgaagatgacgatggttctctgaagaacgtgcacatggctgtgatcagg
ggaaagcagctgagatgcgagttctgccagaagtcgggcgccaccgtcggctgctgcctc
acttcctgcaccagtaactaccacttcatgtgctcgcgggccaagaactgcgtgttcctg
gacgacaagaaggtttactgccagaggcatcgcgacctgatcaaaggagaggtggttcct
gagaatgggtttgaagtccttaggagagtttttgtggactttgaagggatcagtttgaga
agaaaatttcttagtgggttggaaccagagaacatccacatgatgattggctcgatgaca
atagactgtttaggaattctgaatgacctctcagactgtgaagataagttgtttcccatt
ggctatcagtgctcgagggtgtactggagcacaacggatgccaggaagcgctgcgtgtat
acctgcaagatcatggagtgccggccgccggtcatagaacccgacatcaacagcacggtg
gagcacgatgacaacagaacgattgcgcacagccccgttccccttacagaaagtctgcct
aaagacagccgaaacgcgcctgaaatcgtcagcccgccatcgccagatcgtcccttgcac
tctcagacctccggctcctgttacctcccggggggctcgaaggctcccaggctcagggcg
cccagctatccgtccgcgcagaggtcgcccggctcccggccgttgccctccgcaggcagc
cctaccccggtgacccacgaaatagtgacagtgggggatcccttgctgtcctctgggctg
aagagcatcggttccaggagacacagcacctcctctttgtcacagcagcagtcgaaactc
cgcatgatctcccctccacgagccgggagcgcgtactccaggcacagcgtgtcctcggtt
cccagcgcagggacctctgcagaacacgagccgagcggcaaaagcaccgaccgctttgca
ggaccagcgaacgcgggtgctcccagcgctccaggccaaagctgctctgccagctcgggt
gcccagaaaatagcggctgcgagcggaagtaaaacttaccagctggacctgtctcagtct
gcggaaggaaaacattccagcagttcagacctggtagccaaagctgtggcttctaaggga
gagaagatgaaaacgtcaaaggacccagattatctagctcatagttttgcttctggagga
aactccaaagtgtcagctcaactgaccagttcatcgggcacagaaatcaatgttaaaata
ggaaccttccaagaatgttcaggatcgttttcttccaaagaagcaatatccttcccacct
ttgcatcagagaggcccaaggaaggacagagatcagcatgtggaacctgccgcacagcca
gagaaaaccactgtggttgatgaggtggatgcaaagaccctgaaggctgctggagtcaat
agcagatctcctgcagcaagcgagccggtcgcttctgccccaagagacaggcgtcagaag
gggaaaaagttaatgaaagacagctttaaagagaagctttccctgaagtctcttacggat
tcaagccaggcagtaggtggtgatgaaggaaacctgaaactagaattcggtaatcagggt
ttggccaccgaacagattagccagaggttatgtaacaatattcccgctgaaaaagctggt
gagaagtctccaccgtcccaagggcaaccgaaaggttccgcagggcagagcgacgtggcc
tccaaggaaccgcaggcgcctcgcaaacgcaccgttaaagtcactctgacccccctcaag
atggaaagcgaaagccaggctaaaagcgcgcagcaggagggcgatgtggacccgcagtcg
gcgggagcggagccggccgctctggcagagccctcctcggcttcggagagccccgaaggc
aacgccgccgcgcagggaagccccagcgaagcgccagcgcaggaatctcaaagtaacgcc
tatgaaaatttgcccattcaagataacaacttgatgctccaggatggaactaaggctccc
gaagaaggctcgtacaagcggaggtatccacggagaagcgctcgggccaggtccaacatg
ttctttgggctgactcccctgtacggcgtgaggtcctacggagaggaggacattcccttc
tacagcaactccacagggaagaagcgagggaagcggtctgcagaaggacaagtggatggc
gcggatgacttgagcacgtcagatgaagacgacttgtactactataatttcactcgtacg
gtggtttcctcgaacgccgaggagagactcgcgtcccacagcttattcagggaggaggag
cagtgcgatcttccaaaaatctcacagctagacggtgtggatgatggaactgaaagcgat
acgagtgtcacggcaacgacaagaaaagtcagtcaagtgactaaaaggagcagtaaagaa
aacggaacagagaacttgaagctggatagaaccgaggaagccagtgagaaggtacaagtc
accaagagctccgctgtccacaagagcgacccgaagatggacaactgccatcccgtgagc
agggtcaaagcgcaaggccaggactcgctggaggctcagctgagctcgctggagacgggc
cgcagggctcacgccagcacgccttccgacaagaacttactggacacgtttaacactgaa
cttctcaaatctgactctgacaacaacaacagcgatgactgcgggaacatcctgccttcc
gacatcatggacttcgtcctgaagaacacgccgtcgatgcaggcgttgggagagagcccg
gagtcctcgtcctctgaacttctgacgctcggagaaggtttaggtctggacagcaaccgc
ggcaaggatatgggtctgttcgaggtgttctcccagcagctgccgactgccgagccggtg
gacagcagcgtctcttcctccatctcagcggaggagcagttcgagttgccgctggagctc
ccttccgacctctctgtcctgaccacccgcagcccaacggtgcccagccagaaccacaac
aggctcgccgtcatctcggagtcctcgctctcctcctcgggagagaggtccatgctcgcc
ttgccctccgcagagtcgggagaaaagagagtgacggtgacagaaaaatccacctcgggg
gaaggcgatgcggctctcctgagtcctggagtggacccgagccctgagggacacatgact
cccgatcacttcatccagggccacatggatgcggagcacatcgccagcccgccctgcggc
cccgtcgagcagggccacggtggcaaccaggacctgacgagaaacagcggcactccgggc
atcccggtgtcgcccaccgttcccctccagagccagaagtacgtgccaaactccacggac
agccccggcccctcacagatctccaacgctgccgtgcagaccacgccaccgcacctcaag
ccggccgcggagaaactgctggtggtcaaccaaaacatgcagccgctctacgtcctccag
acgctccccaacggcgtcacccagaagatccagctgacgccgtcggtcagctctgcgcag
agcgtgatggagagcggcgcctcggtgctggggcccatgggcagcgggctcacactggcc
acggggctgaatcccagcttgccctcctcgcagtcgctgtttcctcccgcgagcaagggg
ctgctgcccatgccccatcaccagcacatccaccccttctccacgggcagcccgtcacca
gggctgctcatcggcgtgcagccgccccccgacccgcagctcctggtgtccgaggcaagc
cagaggacagaccttggcaccacgtcggcgcctgctgcggccctgggcaagaaacggccg
atatcccgcctgcactcacggaagaacaagaagctggctccctctggaacccctcctgcc
atagctcctcccgatatggtctccaacatgaccctgattaactttgctccttcccagatt
tccaaccacccgctggatttgggaagcattgccaattcaacgtcccacagaaccgtcccc
aatatcatcaagagatccaagtccggggtcatgtattttgagcaaacatctctgctcccg
cagggtgggaccagcgccgcggtcggcacgtctcccagcgtcatcgggccggatgccggt
cacctcccagcggggcccgtgtccggcctggcatcgagctcctcggtgctcaacgtcgtc
tccatgcaggccacggcagcccccacgactggtggctcggttcccggtcatgttttggga
cagagttcggtcacattaacgagccccgggttattaggggacctgggttcgataagcaac
ctcctgatcaaagccagtcagcaaagccttggtctgcaggaccagcacatgactttgcca
cccagttcggggatgttttcacaactgggagcttcccaaactccatctacagcagcgatg
acggctgcgtcgagcatttgtgttctcccttcggcgcagtcgatgggcatgacggtcgct
ccgtcgtctgctgacccagaaggctcttaccagctccagcacatgacgcagctcttggcc
agcaaaaccggggtcgcctcctccccgctggacctcggcacggcgtcggcagcgccgcag
ctgtcaagctttccgcagctggtcgatgttcccaacagtaccgggctggagcaaaccaag
gcgtcctcggcggcgatgcacgccagctcggcctctcccgggggctccccgtcgtctgcc
cagcactctgcgagcggctccgtgctgggccctgcaaaaacaaagctgaaagtcaaacgc
attcagccgtcattagacaaagggaacgggaagaagcacaaaatgtcccacctgtgggcc
agctcctccgaagcgcatgttcctgacagaggggccgttgctggaccccaggtctcggct
acaggggctcctgctgccaaggcagatgcgcaggatgcagcaggcgtcgatcagccgtca
cagcagcagtgtggccagtctgcagggcaaacggcggctctgccagagcctcagtcaccg
cagaacccggcacgtgagcaggagaatgcaggctcaaaagctctcgaggaagaggagagc
actttcagctccccactcatgttttggcttcagcaagagcaaaagcannnnnnnnnnngt
cttggtgagaagaaaccaaagaaaggtttggtttttgagatctctagtgacgatggtttt
cagatctgcgcagaaagcatcgaagatgcctggaagtcgctgacggacaaggtgcaggag
gcccgttccaacgcgcgcctgaagcagctgtccttcgcaggtgtgaacggtttgcggatg
ctggggattatccacgacaccgtcgtgttcctggtcgagcagctgtacggcgcgaagcac
tgccgcaactacaagttccggttccacaagccggaggaggccaacgagcccccgctgaac
ccgcacggctctgcgcgggctgaagtgcacctgaggaagtctgcgtttgatatgtttaac
ttcttggcttctaaacaccgacagccacccgaatacaacccaaatgacgaggaagaggaa
gaagtgcagctgaaatcagcccggagggcaaccagtatggatctgccgatgcccatgcgc
ttccgacacttgaagaagacctccaaggaggcagttggtgtctacaggtctcccatccac
ggcagggggctgttctgcaaaaggaacatcgatgcaggtgagatggtgatcgaatattca
ggcaatgtcattcgctccatcctcactgacaaacgggagaaatactacgacagtaagggc
atcggctgctacatgttccgcatcgacgactcggaggtggtggacgccaccatgcacggg
aacgcggcgcgcttcatcaaccactcctgcgagcccaactgctactcccgcgtcatcaac
atcgacggccagaagcacatcgtcatcttcgctatgcgcaagatctaccgtggggaggag
ctcacctacgactacaagttccccatcgaggacgccagcaacaagctgccctgtaactgc
ggcgccaagaagtgcaggaagtttttaaactag

DBGET integrated database retrieval system