KEGG   Columba livia (rock pigeon): 102085082Help
Entry
102085082         CDS       T02912                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  
transglutaminase 3 [EC:2.3.2.13]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102085082 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 692 aa AA seqDB search
MGQAATRSSINWHLKENARDHHTSKFSSKELIVRRGQAFIISFNGTEQPEQNLIFIAETG
PKPSKLSKTQATFGISSTVSKDSWSAVLQSTSSSSVSISISSPPDAVIGRYKLSVQSTLS
GTSSPASLGTFVLLFNPWSSGDDVFMHNKAECEEYVLEEFGIIFAGNKNRISSFGWNFGQ
FQGDILNICLSMLDRSLNYRQDPATDVSHRNDPKYLGRVLSAMVNANDDQGVLLGNWSGN
YEGGKSPSSWTGSGEILQNWKKSGFKPVRYGQCWVFAAVLTTVLRCLGIPTRTITNFSSA
HDADGNLRVDEFYDASGNHLDRAADSIWNFHVWNESWFSRSDLGPSYGGWQVLDATPQEE
SGGIYQCGPASRNAIKEGDVDLDYDCPFVFAEVNADCMYWNYDLTTGKKTLIFSKSTTIG
QFISTKAVGRDDRVDITNDYKYEEGSKKERDIFKKARKKLGLEDKFDPTAPTPQETDQKP
DISGKFKVDGLLEVGKDLNLILILANLQSDAKAVNVNMTAWSTVYTRRPIHEIWKDSISV
TLSPKEEKQFPIKIPYTEYQQQLTTDNTIQVTALCHVEGGIQVLVQRDITLDNPAIDIKV
PGEAKVNEEVDVEVIFTNPIETEVTNCVLQVEGNDLLRGILEIGVPPLKAREKSSMKFKL
IPFETGPKHLLVNFSCDKFADIKAFKMVNVID
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagctgcaacgcggtcaagtatcaactggcacctgaaagaaaatgcaagagat
caccacacaagtaaattttctagcaaagagttgattgtgaggagaggacaggccttcatt
atctccttcaatggaacagaacagcctgagcaaaacttaatattcatcgcagaaacaggt
ccaaaaccctcaaagctgtctaagacccaggctacatttggtatctccagcacagtgagc
aaggacagctggagtgcagttctacagtccaccagttccagctccgtgagcatctccatt
tccagcccacctgatgctgtcattggacgttacaagctgagtgttcaaagtactctgagt
ggtacctcctctccagcaagccttggcacttttgttttgctctttaacccttggtcttca
ggtgatgacgtgttcatgcataacaaggctgagtgtgaagaatatgtgctagaagaattt
ggcatcatttttgcgggcaataaaaatcgtatcagcagctttggatggaattttggccag
tttcaaggagatattctcaatatttgcctttccatgctggatcgaagcttaaactatcgt
caggatcctgccacagatgtatctcaccgcaatgaccccaaatatctgggccgcgttctc
agtgcaatggtcaacgccaatgacgatcaaggggtgctcctaggaaactggagtggaaat
tatgagggtgggaaaagtccgagcagctggaccggaagtggtgaaatcctgcaaaactgg
aagaaatcaggattcaaaccagttagatatggacaatgctgggtttttgcagctgtattg
actacagtgcttagatgtctgggaattcccactcgtacaattacgaacttcagctctgcc
cacgatgcagacggaaatctgcgtgtggatgagttttatgatgcttctggaaatcacttg
gacagggcggctgacagcatatggaatttccatgtctggaatgaaagctggttttcccgc
agtgacttgggcccctcatatggtggatggcaagttctggatgcgactccccaagaagaa
agtggaggaatttatcagtgtggtcctgcctcacggaacgccatcaaagaaggagatgta
gatctggactacgactgtccattcgtatttgcagaagtgaatgctgactgtatgtactgg
aattatgacctcacaactggaaagaaaacattgatattctctaagtctaccacaattggc
caattcatcagcacaaaggcagttggtagagatgatcgtgtggatatcaccaatgattat
aaatatgaagaaggctctaaaaaagaaagagatatttttaaaaaagcccgtaagaagctg
ggacttgaggacaaatttgatcctacagcaccaacacctcaggaaactgatcaaaagcct
gatatctcagggaagttcaaggtggatggccttttagaagttggcaaagatctcaatcta
attctgattcttgcaaacttacagtctgatgctaaggctgttaatgtaaatatgactgct
tggagcactgtgtacactagaagaccaattcatgagatctggaaggactcgatatctgtc
actctgtctcctaaggaagagaaacaatttcctattaagataccatatactgaatatcaa
cagcagttaactacagacaacacgatccaggtaacagcgttatgtcacgtagaaggtgga
attcaagtgctagtacaaagagacatcaccctggacaaccctgccattgatataaaggta
cctggtgaagcaaaggtgaatgaagaagtagatgtagaagtgatatttaccaatcctatt
gaaacggaagtgacgaactgtgtgctgcaggtagaaggcaatgacttgctcagaggaatc
cttgagataggtgtgccaccgctgaaagcccgtgagaaatccagtatgaagtttaaactc
atcccttttgagacgggtcccaaacatctacttgttaatttctcctgtgataaatttgca
gatatcaaggcctttaagatggtaaacgtgattgactaa

DBGET integrated database retrieval system