KEGG   Columba livia (rock pigeon): 102088765Help
Entry
102088765         CDS       T02912                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00010  Glycolysis / Gluconeogenesis
clv00051  Fructose and mannose metabolism
clv00052  Galactose metabolism
clv00500  Starch and sucrose metabolism
clv00520  Amino sugar and nucleotide sugar metabolism
clv00524  Neomycin, kanamycin and gentamicin biosynthesis
clv01100  Metabolic pathways
clv01200  Carbon metabolism
clv04910  Insulin signaling pathway
Module
clv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
clv_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102088765
   00051 Fructose and mannose metabolism
    102088765
   00052 Galactose metabolism
    102088765
   00500 Starch and sucrose metabolism
    102088765
   00520 Amino sugar and nucleotide sugar metabolism
    102088765
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102088765
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    102088765
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102088765
Membrane trafficking [BR:clv04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102088765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 102088765
NCBI-ProteinID: XP_005512814
UniProt: A0A2I0MFB9
LinkDB All DBs
Position
Unknown
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKEDQVKKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMESEIYNTPEDIMH
GSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASGV
EGADVVRLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYME
EMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRLG
VEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKMH
PQYARRLHKTTRRLVPDSEVRFLLSESGSGKGAAMVTAVAYRLAEQHRLIDETLAEFKLT
HEQLLQVKKRMRAEMEAGLKKKTHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLGF
TFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTVG
TMMTCAYEDPNCEIGLIVGTGSNACYMEEMRNIEMVDGEQGRMCVNTEWGAFGDNGCLDD
IRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTRH
IFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSIIVKTVCGAVSRRAAQLCGAGMAA
VVDKIRENRGLERLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPNCDVTFLLSEDGSGKG
AALITAVGCRLRDAEQN
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcccagctcctggcctactacttcacggagctaaaggaggaccaggtcaaa
aagattgacaaatacctttacgccatgcggctgtctgacgagacgttgatagacattatg
gctcgcttcaggagagagatgaagaacggcctctcccgagatttcaacccaacggctaca
gtgaagatgctccctacgtttgtgaggtccattcccgacggttcagagaagggagatttc
attgcgctggaccttggcggttcatatttccgaattctgcgggtgaaggtatcgcatgag
aaaaagcagacggtgcagatggaaagcgaaatttataacacgcctgaagatatcatgcac
ggcagcgggacacggctttttgaccatgttgctgaatgcttgggagactttatggagaaa
cagcaaatcaaagacaagaaattaccagtggggtttacgttttcattcccttgtcgacaa
tccaagctggatgagggcattctaataacctggacgaaacgcttcaaagcaagtggagtg
gagggagcagatgttgtgaggctgctgaacaaggccatcaagaaacgtggggactacgat
gcagatatcatggctgttgtgaatgacactgtcgggactatgatgacctgtggctttgat
gaccagcgttgtgaagttggcttgatcattggcaccggcaccaacgcctgctacatggag
gagatgcggcacatcgacctggtggaaggggacgagggcaggatgtgcattaacacggag
tggggggcctttggagatgatggctccctggaagacatcaggactgagtttgatcgagag
attgaccgtggatcccttaatcctgggaagcagctgtttgagaagatggtcagtgggatg
tacatgggggagctggtgaggctcatcctggtgaagatggccaaggagggcctgcttttt
gaggggagaatcacccccgagctcctcaccaaagggaagtttgaaacgaagcacgtttcc
gccatagagaagagcaaagaaggtttgaacaaagccaaagaaatcttgacgcgcctgggg
gtggagccgtcccacgaggactgcatcgccgtccagcacgtctgcaccatcgtgtccttc
cgctcggccaacctggtggcctccacgctgggcgccatcctcaaccagctgcgcgataac
aaaggggtcggccgcctccgcaccaccgtgggggtcgatggctccctctacaagatgcac
ccgcagtacgcccggcgcttgcacaaaaccacccggcgcctggtgcccgactcggaggtt
cggttcctgctgtcggagagcggcagtgggaagggagcggccatggtgacggcagtggcg
taccggctggcggagcagcaccggctcatcgacgagacactggccgagttcaagctcacc
cacgagcagctgctgcaggtgaagaagaggatgagggcagagatggaagcggggctgaag
aagaagactcacgagactgccaaggtgaagatgctgcccacgttcgtccgcagcacgccg
gacgggacagagaacggagacttcctggcactcgaccttggagggacaaacttcagagtt
ttgctggtgaaaatccgcagcggtaagaggagaacggttgagatgcacaacaagatctat
gccatccccatagaggtgatgcagggaacgggagaagagctgtttgatcacatcgttacc
tgcatttctgacttcctggattacatgggcataaaaggcgcacgtcttcctctcggcttc
acgttttccttcccttgcaagcagaccagtctggatgccggtatccttctcaattggaca
aaaggctttaaagctacagactgcgagggagaagacgtggtgtatttacttagagaagga
attaaaagaagagaggagtttgacttggacgtggtggccgtggtgaacgatacggtgggc
acaatgatgacttgtgcttatgaagacccaaactgtgaaatcggactcatcgtgggaact
ggcagcaacgcctgttacatggaggagatgaggaacatagagatggtggatggcgagcag
gggcggatgtgcgtgaacacggagtggggagcgttcggagataacggatgcctggacgat
atcaggacgatttatgacaaagcggttgatgactattcactaaatgctggaaagcaaagg
tacgagaagatgatcagcgggatgtacctgggggaaatagtccgcaacattttgatcgac
ttcaccaaacgggggttcctgttcagaggccagatttcggagacactgaagacccgacat
atctttgaaaccaagttcctttctcagatcgagagtgacaggctggccttgctgcaggtg
cgagccatcctccagcagctggggctcaacagcacctgcgacgacagcatcatcgtcaag
acggtgtgcggcgccgtgtccaggcgagcggcgcagttgtgcggtgctggaatggctgcg
gttgtagataaaattagggagaacagaggattagagcgcctggagataacggttggtgtg
gatgggactctgtacaaactgcacccacacttttcgaggattatgcaccaaacagtcaaa
gacctggcacccaactgcgacgtgaccttcctgctgtccgaggacggcagcgggaagggg
gccgcgctcatcacggccgtgggatgcaggctgcgcgatgccgagcagaactga

DBGET integrated database retrieval system