KEGG   Columba livia (rock pigeon): 102090265Help
Entry
102090265         CDS       T02912                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  
glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102090265 (GPD2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102090265 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
SQFSQYRNKHGAFAHVQAAEAVSVPVKSHLPSREEQILALQTTDEFDVLVIGGGATGCGC
ALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVRYLQKAIMKLDLEQYRMVKEALEER
ANLLEIAPHLSAPLPIMLPVYKWWQLPYYWLGIKLYDMVAGSQCLKSSYVLSKSRALELF
PMLRKDKLVAAIVYYDGQHNDARMNLAIALTAARYGAATANYAEVLRLLKRTDPAGGKER
VCGVRCRDVLTGQEFDVKAKCVINATGPFTDSVRKMDDQEVPNICQPSAGVHIVMPGYYS
PDHMGLLDPATSDGRVIFFLPWEKMTIAGTTDSPTDVTSHPIPTEEDINFILNEVRNYLS
VDVEVRRGDVLAAWSGIRPLVTDPNSKDTQSISRNHVVTISDSGLVTIAGGKWTTYRAMA
QDALDAAVQAHSLRAGSSRTISLQLEGAEDWSPTLYIRLVQDYGLESEVAQHLASTYGDK
AYEVAKIAQVTGKRWPIVGKRLVSEFPYIEAEVVYGVREYARTAVDMISRRTRLAFLNVQ
AAEEALPRIVDIMGKELNWSEQKKKEELEAAKKFLYYEMGYKVKTDQLTDSSEISLLPSD
IERYEKRFHMFDKDKKGFITILDVQRVLESIGVQIAENTLHEILNEVDLNKNGQVELNEF
LQLMSAIQKGHVSGSRLAVLMKTAEENLRQRVLISVDRSGGGG
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
tctcaattttctcagtatagaaacaaacacggcgcctttgcgcacgttcaagctgcagaa
gccgtgagcgttccagtaaagagccatctccccagcagagaagagcagatcttggcgctg
cagaccacggatgagtttgatgtcctggtgataggcgggggagccacgggctgcggctgc
gccttggatgccgtcaccagaggactaaaaacagcccttgtggaaagagatgatttctca
tcggggaccagcagcaggagcacgaagctgatccacggcggggtgaggtatcttcagaag
gccatcatgaagctggatttggagcagtacaggatggtgaaagaagcacttgaggagcgt
gcaaatctgcttgaaattgctccccacctgtcagctcctctgccgataatgctgcccgtg
tacaaatggtggcagctgccgtactactggcttggaataaaactgtacgacatggtggct
ggaagtcagtgtctgaaaagcagttacgtccttagcaagtcgagagccttggagctcttc
ccaatgctacgcaaagacaagcttgttgcagccattgtctactatgacggacagcacaac
gacgcacggatgaacctcgccatcgccctcactgctgccaggtacggggctgccaccgcc
aattacgctgaagtgctgcgcctgctcaagaggacagacccggccggcgggaaggagcgc
gtctgcggggtgcgctgcagggacgtcctcacagggcaggaatttgatgtcaaagccaaa
tgtgttatcaatgctacgggacctttcacagactcggtgcgcaaaatggatgatcaggag
gtgcccaacatctgtcagcccagcgcgggcgtgcacattgtcatgcctggttattacagc
cctgaccacatgggcctgctggacccggccaccagcgacgggcgcgtcatcttcttcctg
ccctgggagaagatgacgatcgcggggaccacggacagcccgaccgacgtcacctcccac
cccatccccaccgaggaggacatcaacttcattctgaacgaagtgcgcaactacctgagc
gtggacgtggaagtgagaagaggagacgtgttggcagcgtggagcggcattcgtcctctg
gtcacagaccccaactccaaagacacgcagtcgatatcccggaatcacgttgtcaccatt
agcgacagtggccttgtcaccatagcaggtgggaagtggacgacgtaccgcgccatggcg
caggacgcgctggacgcggcggtgcaggcgcacagcctgcgggccggctccagcaggacc
atcagcctgcagctcgagggggccgaggactggagccccacgctctacatccggctggtc
caggactacggactcgaaagtgaggtggctcagcatctggcttcgacgtatggtgacaag
gcttacgaggtggccaaaatagcccaagttacagggaagagatggcctattgtcggaaaa
cggctggtatctgaatttccttatattgaagctgaggtggtgtatggcgtcagggagtac
gcccgcacggccgtggacatgatttcccggcgcactcgcctggcctttctgaacgtgcag
gctgcggaggaggccctgccgaggatcgtggatatcatgggcaaggaacttaactggagc
gagcagaaaaaaaaggaagaacttgaagctgctaaaaaatttctctattatgaaatgggc
tacaaagtaaaaacggatcaattaacagacagctctgaaatcagcctcctgccttcggat
attgaaaggtacgagaagcgattccacatgtttgacaaggacaagaaaggctttattact
atactggatgtgcagcgtgtcttggagagcatcggtgtgcaaattgctgagaatactctt
catgagattctaaatgaagtggatctgaacaaaaacgggcaggtggagctcaatgagttt
ttacagctgatgagcgccatccagaagggccacgtgtcgggcagccggctggcggtgctg
atgaagacggcggaggagaacctgcggcagcgggtgctgatctcggtggaccgcagcggc
ggggggggctga

DBGET integrated database retrieval system