KEGG   Columba livia (rock pigeon): 102091387Help
Entry
102091387         CDS       T02912                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    102091387
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102091387
   00982 Drug metabolism - cytochrome P450
    102091387
   00983 Drug metabolism - other enzymes
    102091387
Enzymes [BR:clv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102091387
Transporters [BR:clv02000]
 Other Transporters
  Pores ion channels [TC:1]
   102091387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 242 aa AA seqDB search
MSGDHSRSLAKGSAAPGPVPEGLIRLYSMRFCPFAQRARLVLRAKGISHEVININLKNKP
DWFFEKNPFGLVPVLETSKGQLIYESPITCEYLDEAFPGKKLMPSDPYERALQKMLLEHF
SKLTSIVFKHVMAVKEGQDTTALKAEIAEKLDKFEEILSKRNTVFYGGDSISMLDYMMWP
WFERLEALQLKDSLSHTPKLQHWMEAMKEDPAVKATMTDPQIYKDYLQLYLKNSPEACDY
GL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcgaccactctcgcagcttggccaagggcagcgcggcccctgggcccgtgccc
gagggcctgatccggctgtacagcatgcggttctgccctttcgcccagcgggcgcgtctt
gtcctccgcgccaagggcatcagccatgaagtaattaacatcaatctgaagaacaaacct
gactggttctttgagaagaacccctttgggctggttcctgttctggagaccagcaagggc
cagctgatctacgagtccccaatcacttgcgaatatttggatgaagcatttccagggaag
aagttgatgccttcagacccatatgagcgagcccttcagaagatgctcttggaacacttc
tcaaagttaacatccatagttttcaagcatgttatggcagtcaaagaagggcaggacacc
accgcactcaaagcagagattgctgaaaagcttgacaaatttgaagagattctgtccaaa
cgcaacactgtgttttatggtggggactcaatctccatgcttgactacatgatgtggccg
tggtttgaacgtctggaagcattgcagctgaaggactctttgagtcacaccccaaagctc
caacactggatggaggccatgaaggaggaccctgctgtcaaggctacaatgactgacccc
cagatatacaaagattacctccagctctatttgaagaacagccctgaggcatgtgattat
gggctctga

DBGET integrated database retrieval system