KEGG   Columba livia (rock pigeon): 102093871Help
Entry
102093871         CDS       T02912                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  
succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102093871 (SDHA)
  Energy metabolism
   00190 Oxidative phosphorylation
    102093871 (SDHA)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102093871 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 682 aa AA seqDB search
MGDLYCGDENFDCCKAKTGYGSSSWKHLFYDSCLDFFPQWPAACQTLARNLHFTVHGKKN
ASTKVSDSISTQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVA
AQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIELENYGMPFSR
TEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFAL
DLLMENGECRGVIALCIEDGTIHRFKAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTR
AGLPCQDLEFVQFHPTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDV
VSRSMTIEIREGRGCGPEKDHVFLQLHHLPPQQLATRLPGISETAMIFAGVDVTKEPIPV
LPTVHYNMGGIPTNYKGQVITHVNGQDKVVPGLYACGEAACASVHGANRLGANSLLDLVV
FGRACALTIAETCKPGEPIPSIKPNAGEESVANLDKLRFANGTIRTSEVRLNMQKTMQNH
AAVFRTGSVLQEGCEKISQIYGDLAHLKTFDRGIVWNTDLVETLELQNLMLCALQTIYGA
EARKESRGAHAREDYKVRVDEFDYSKPLQGQQQKPFEQHWRKHTLSYVDVPSGKVTLKYR
PVIDRTLNEEDCSTVPPAIRSY
NT seq 2049 nt NT seq  +upstreamnt  +downstreamnt
atgggagatctgtactgtggagatgaaaattttgactgttgtaaagcaaagactggatat
gggtcttcctcgtggaaacatttgttctatgacagttgtcttgacttctttccgcagtgg
ccagcagcatgccagactctcgcacgcaacttgcacttcacagtccatggaaagaaaaat
gcttctacaaaggtttctgattcgatttccacacaatatccagtagtggaccatgaattc
gatgcagttgttgtgggtgcaggaggagcaggtctgcgggctgcgtttggtttgtcagag
gctggatttaatacagcatgtgttacaaagctgtttcccaccagatctcatactgttgct
gcacagggaggaatcaatgctgctctgggaaatatggaggacgataactggaggtggcat
ttctatgacacagtgaaggggtctgactggctgggtgaccaggatgccatacactacatg
accgagcaagcccccgctgcggtgatagagctggaaaattatgggatgccgttcagcaga
acggaagaaggaaaaatctatcagcgtgcatttggtggccagagtcttcagtttggaaaa
ggaggacaggctcacagatgctgttgtgttgcagacaggacaggacactcactgttacat
actctgtatggcaggtctctaagatatgatacaagctactttgttgagtattttgccttg
gacctactgatggaaaatggagaatgtcgtggtgttattgccctttgcattgaagatggc
actatacatcgctttaaagcaaagaacactgtcattgccactggtgggtacggccgcact
tacttcagttgtacatctgctcatactagtacgggtgatggcactgctatggtcacacga
gctggtcttccttgccaggacttagaatttgtacagtttcaccctacaggtatctatggg
gctggctgccttataacggaaggatgtcgtggagagggaggtattctaattaacagtcaa
ggtgaaagatttatggagagatacgctcctgttgctaaggatctggcttccagggatgta
gtatctcgttctatgaccatagaaatccgtgaaggaaggggttgtggtcctgaaaaagac
cacgtgttcttgcagttacaccacttaccaccacagcagctagcaacccgtctcccagga
atttcagaaacagcaatgatatttgctggagttgatgtcactaaagagcctattcctgtt
ctgccaactgtgcattataatatgggaggtattcctactaactacaaagggcaggtgatt
acacatgtgaatggtcaggataaagtggtacctggtttatatgcttgtggggaagcagcc
tgtgcatctgtccatggcgcaaatcgacttggagcaaactcacttctggatctggtggtc
tttggtcgtgcttgtgcccttactattgcagagacgtgcaagcctggagagccaattccc
tccattaaaccaaatgctggtgaagaatcagttgctaatcttgacaaattaagatttgct
aatggaaccataagaacttcagaagtgcgacttaacatgcagaagacaatgcaaaaccac
gctgctgtatttcgtactggttctgtactccaagaaggctgcgagaaaattagccaaatt
tatggtgatctggctcatctaaagacatttgatagaggtattgtgtggaacactgacttg
gtggagactcttgaactgcagaacctgatgctttgtgctctacaaaccatttatggtgct
gaggctcgcaaagagtcccggggtgctcatgcaagagaggactataaggtacgggtagat
gagtttgactattctaagccactccaaggccaacaacagaagccatttgaacaacactgg
aggaagcacaccctttcgtatgtggatgtcccatctgggaaggttactttgaaatacaga
cctgtgatcgacagaactttgaatgaagaagactgctccactgtcccacctgctattcgc
tcatactag

DBGET integrated database retrieval system