KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_00341Help
Entry
CMN_00341         CDS       T02530                                 

Gene name
ppcA
Definition
(GenBank) Cmm ortholog CMM_0383; Cms ortholog CMS_1939
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CMN_00341 (ppcA)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMN_00341 (ppcA)
  Energy metabolism
   00680 Methane metabolism
    CMN_00341 (ppcA)
Enzymes [BR:cmc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CMN_00341 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
342547..345279
Genome map
AA seq 910 aa AA seqDB search
MTTPPKKPLPLEHDSTRDGTRDAVEPALRSDVSHLGGLLGQVLRESGGDDLLRDVERLRE
LVIDAYESARDASIDDAERLVATFTPERAEQVARAFTCYFHLANLAEEHHRVRVLREREA
ASGFVPDSIPDAVGKLTEELGREEAMRRLGEMRFHPVLTAHPTEARRRAVATGIRRIGDL
LTERDGAMAGTLTGQDVDRRLLEEIDGLWRTSPLRTTRPTPLDEVRTAMGVFDQTLFEVV
PRVYRLLDDWLLGDEAGARDAVAPAFFRLGNWIAADRDGNPYVTAAVTEEAAGIASEHIL
LGLERVALRVGRSLTLGDADTPPSAELRELAAAQDALAPHLTARIGTRAPAELHRRVLLV
IAGRLAATRERHDDPIAYPSAAELLADLRVLQASLRSAGAHRIAGGELQGLVWQAETFGF
HLAEMEVRQHSQVHREALREVLAVASADASGEQAPELAPMTVEVLDVFRTLARLQQRHGV
APFSRFIVSFTQSADDIRTVHELAALALGSAEEAPVLDVIPLFETFADLNASTEILDGMI
RLPQVAARLAQTGRKLEVMLGYSDSSKDVGPVSATFALFDAQARIAAWARENDIELTLFH
GRGGALGRGGGPADRAVRAQPPGSVDGRFKLTEQGEVIFAHYGDKRIAARHIEQMAAATL
LASAPSNEERNAAAAHGSADMVRTMDEASRARFFELVKAPGFAPWFAQVTPMEEIGLLAL
GSRPARRGLSVESLEDLRAIPWVFAWTQARINLTGWFGLGSALAAVGDEDVLRKAYDEWP
LFTSMIDNVEMSLAKTDGRLAERYLALGDRPDLAALVTEEMELTREWVRKATGRGEILEG
RPVLRRAVRLRSPYVDALSLLQLRALRALRTAASDATGQAAPGQADPTDPDHRLLLLTVN
GIAAGLQNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgacgactcccccgaagaagccgcttcccctcgagcacgactccacccgcgacggcacc
cgcgacgccgtggagcccgccctccgctccgacgtcagccacctcggcggcctgctcggc
caggtgctccgcgagtccggcggggacgacctgctgcgcgacgtcgagcggctgcgcgag
ctggtcatcgacgcgtacgagagcgcgcgcgacgcgtccatcgacgacgccgagcgcctc
gtcgcgaccttcacgcccgagcgcgccgagcaggtcgcccgcgcgttcacctgctacttc
cacctcgccaacctcgccgaggagcaccaccgcgtgcgcgtcctgcgcgagcgcgaggcc
gcctcgggcttcgtgcccgactccatcccggacgccgtcgggaagctcaccgaggagctc
ggccgcgaggaggccatgcgccgcctcggcgagatgcggttccacccggtgctcaccgcg
caccccaccgaggcgcgtcgtcgggcggtggccacggggatccgccgcatcggcgacctg
ctcaccgagcgcgacggcgccatggcgggcacgctcaccgggcaggacgtcgaccgccgg
ctgctcgaggagatcgacggcctgtggcgcacgtcgccgctgcgcaccacgcggcccacg
ccgctcgacgaggtccgcaccgccatgggcgtcttcgaccagaccctgttcgaggtcgtg
ccgcgcgtctaccgcctgctcgacgactggctgctcggcgacgaggccggtgcgcgcgac
gcggtggcgcccgccttcttccggctcggcaactggatcgcggcggaccgcgacggcaac
ccgtacgtcaccgcggcggtcaccgaggaggccgcgggcatcgccagcgagcacatcctc
ctgggcctcgagcgcgtcgccctccgcgtgggccgctcgctcaccctgggtgacgccgac
accccgccgagcgccgagctccgcgagctcgccgccgcgcaggacgcgctcgcgccgcac
ctcaccgcccgcatcggcacgcgcgccccggccgagctgcaccgccgcgtgctgctcgtg
atcgccggccgcctcgccgccacgcgcgagcgccacgacgaccccatcgcctatccgtcg
gccgccgagctgctcgccgacctccgtgtgctgcaggcgtcgctccgcagcgccggcgcg
caccgcatcgcgggcggcgagctgcagggcctcgtctggcaggccgagaccttcgggttc
cacctcgccgagatggaggtgcgccagcactcgcaggtgcaccgcgaggcgctgcgcgag
gtgctggctgtcgcctcggccgatgcgtccggcgagcaggcgcccgagctcgcgcccatg
acggtcgaggtgctcgacgtcttccgcacgctcgcccgcctgcagcagcggcacggcgtc
gcgccgttctcgcgcttcatcgtctcgttcacgcagtcggccgacgacatccgcacggtg
cacgagttggccgcgctcgccctcgggtcggcggaggaggcgcccgtcctcgacgtcatc
ccgctgttcgagacgttcgcggatctcaacgcgagcaccgagatcctcgacggcatgatc
cggctgccccaggtcgcggcgcgcctcgcgcagacgggccggaagctcgaggtcatgctc
ggctactccgactcgtcgaaggacgtcgggcccgtctccgcgacgttcgcgctgttcgac
gcgcaggcgcgcatcgccgcgtgggcgcgcgagaacgacatcgagctcacgctcttccac
ggccgcggcggcgcgctcggccgcggcggcgggccggccgaccgcgccgtgcgggcccag
ccgccgggatccgtcgacggccgcttcaagctcaccgagcagggcgaggtgatcttcgcc
cactacggcgacaagcgcatcgccgcccggcacatcgagcagatggccgccgcgaccctg
ctggcctcggcgccctcgaacgaggagcgcaacgcggccgccgcgcacgggtcggcggac
atggtccgcacgatggacgaggcctcgcgcgcccgcttcttcgagctcgtgaaggcgccg
gggttcgcgccgtggttcgcgcaggtcacgcccatggaggagatcgggctgctcgcgctc
ggctcgcgtccggctcgccgcggcctgtcggtcgagtcgctcgaggacctgcgggcgatc
ccgtgggtgttcgcgtggacgcaggcgcgcatcaacctcaccggctggttcggcctcgga
tccgcgctggccgccgtcggcgacgaggacgtgctccgcaaggcctacgacgagtggccg
ctgttcacctcgatgatcgacaacgtcgagatgtcgctcgccaagaccgacggccgcctc
gcggagcgctacctcgcgctcggcgaccggccggatctcgcggcgctcgtcaccgaggag
atggagctcacgcgcgagtgggtgcggaaggccaccggccgcggcgagatcctcgagggc
cgaccggtgctgcgacgcgcggtgcgcctgcggagcccctacgtcgacgcgctgtcgctg
ctccagctgcgggccctgcgcgcgctgcggaccgcggcttccgacgcgaccggccaggct
gcccccggtcaggccgacccgacggatccggaccaccggctcctgctgctcaccgtcaac
gggatcgcggcggggctgcagaacacggggtga

DBGET integrated database retrieval system