KEGG   Clavibacter nebraskensis: CMN_00565Help
Entry
CMN_00565         CDS       T02530                                 

Gene name
pfkA
Definition
(GenBank) Cmm ortholog CMM_0604; Cms ortholog CMS_2832
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cmc  Clavibacter nebraskensis
Pathway
cmc00010  Glycolysis / Gluconeogenesis
cmc00030  Pentose phosphate pathway
cmc00051  Fructose and mannose metabolism
cmc00052  Galactose metabolism
cmc00680  Methane metabolism
cmc01100  Metabolic pathways
cmc01110  Biosynthesis of secondary metabolites
cmc01120  Microbial metabolism in diverse environments
cmc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CMN_00565 (pfkA)
   00030 Pentose phosphate pathway
    CMN_00565 (pfkA)
   00051 Fructose and mannose metabolism
    CMN_00565 (pfkA)
   00052 Galactose metabolism
    CMN_00565 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    CMN_00565 (pfkA)
Enzymes [BR:cmc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CMN_00565 (pfkA)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CMN_00565 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: CCE74529
UniProt: M5B8C2
LinkDB All DBs
Position
complement(551240..552265)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGTTIHKQEFVGFRDGWRGVVDGDVMPLARRDIQGI
GKQGGTILGTSRTNPFEGDGGVERIQENLDRLGIDAILAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATDAMDRLRTTGDSHSRCMVAEVMGRHVGWIALHS
GMAAGAHAILIPEQKTSMDEIIGWVRSAYDRGRAPLVVVAEGFIPEHASDAHGERGLDAF
GRPRLGGIGEQIAPIIEERTGIETRATTLGHIQRGGTPSSYDRVLATRLGLAAVDSVRDG
HWGRMVALRGTDIVHVGFEEALGRLKTVPQHRYDEAAILFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggaatcctcacctcaggcggagactgccccggactcaacgcggtcatccgt
ggggcggtgctcaagggaacgaccatccacaagcaggagttcgtgggcttccgcgacggc
tggcggggtgtcgtcgacggcgacgtcatgccgctcgcgcgccgcgacatccagggcatc
ggcaagcagggcggcacgatcctcggcaccagccgcacgaacccgttcgagggcgacggc
ggcgtggagcggatccaggagaacctcgaccgcctcggcatcgacgcgatcctcgccatc
ggcggcgagggcacgctcgcggccgcgaagcgcctcaccgacgcggggctcaagatcgtc
ggcgtccccaagaccgtcgacaacgacctcgacgccaccgactacacgttcggcttcgac
accgcggtgcagatcgcgaccgacgccatggaccgcctccgcaccacgggcgactcgcac
agccgctgcatggtggccgaggtcatgggccgccacgtcggctggatcgcactgcactcc
ggcatggccgcgggcgcgcacgcgatcctcatccccgagcagaagacgagcatggacgag
atcatcggctgggtccgctccgcctacgaccgcgggcgcgctccgctcgtcgtcgtcgcg
gagggcttcatccccgagcacgcgtcggacgcgcacggcgagcgcgggctcgacgccttc
ggccgcccgcggctcggcggcatcggcgagcagatcgcgcccatcatcgaggagcgcacg
ggcatcgagacccgggcgacgaccctcggccacatccagcgcggcggcaccccgtcgtcg
tacgaccgcgtgctcgccacccgcctcggcctcgccgcggtcgacagcgtgcgcgacggg
cactggggccgcatggtcgcgctccgcggcaccgacatcgtgcacgtgggcttcgaggag
gcgctcggccgactcaagactgtgccgcagcaccgctacgacgaggccgcgatcctcttc
ggctga

DBGET integrated database retrieval system