KEGG   Cyanidioschyzon merolae: CymeCp014Help
Entry
CymeCp014         CDS       T00175                                 

Gene name
rbcS
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  
ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
cme  Cyanidioschyzon merolae
Pathway
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CymeCp014 (rbcS)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CymeCp014 (rbcS)
Enzymes [BR:cme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     CymeCp014 (rbcS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
CP:8989..9405
Genome map
AA seq 138 aa AA seqDB search
MRVTQGTFCYLPDLTDEQIRKQIQYAINQGWAVSVEYTDDPHPRNSYWEMWGLPLFDVKD
PATIMFEVQECRKQFPNHYIKVLAFNSTKGIESTALSFIVNRPANEPGFVLRRIESNDRV
QRYQIHSYATEKPEGSRY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagagtaacgcaaggtaccttttgttatttacccgacctaaccgacgaacaaattcgc
aaacaaattcaatatgccatcaatcaaggatgggctgtaagtgtggaatataccgatgat
ccacatccacgtaattcttattgggaaatgtggggattacctctatttgatgtgaaagac
cctgctacaatcatgtttgaagttcaagaatgccgtaaacaatttccaaatcattatatc
aaagtattggcattcaactcgactaaaggtatcgagtccacagcattatcttttattgtg
aatcgacctgcaaacgaaccaggattcgtactcagacgtattgaatctaatgatcgtgta
caaagatatcagattcacagctacgctacagaaaagccagaaggttcaagatattaa

DBGET integrated database retrieval system