KEGG   Chlamydia muridarum Nigg3 clone G28.38.1: NC81_02865Help
Entry
NC81_02865        CDS       T03405                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cmg  Chlamydia muridarum Nigg3 clone G28.38.1
Brite
Enzymes [BR:cmg01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     NC81_02865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Imm3
Motif
Other DBs
NCBI-ProteinID: AIT91996
UniProt: A0A069ZYC9
LinkDB All DBs
Position
complement(677493..678110)
Genome map
AA seq 205 aa AA seqDB search
MVFSSYKLPDLPYDYDALEPVISAEIMHLHHQKHHQGYINNLNEALKSLDVASATQDLTG
LIAINPALRFNGGGHINHSLFWEMLAPQNKGGGTPPRHELLKLIEKFWGSFDNFLKNFIS
SSAAVQGSGWGWLAFCPKKQELMIQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKNAR
LDYLKNFPSIINWDYIESRFVEMSK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggttttttcttcttataagcttcccgatttaccttatgattacgatgctttggaacct
gtaattagcgcggagattatgcatctccaccatcaaaaacatcatcaaggatatataaat
aatttgaatgaagctttgaaaagcttggatgtagcaagtgctactcaggatctcacggga
ttaatcgcaattaacccagctttgcgtttcaatggcggggggcatattaatcattcattg
ttttgggaaatgctagcgccacaaaacaaaggcggagggactccacctcgtcatgagttg
cttaagttaatagaaaaattttggggctctttcgacaattttttaaaaaattttattagt
tcttctgctgccgtacagggatccggctggggttggttggctttttgtcccaaaaaacaa
gagcttatgatacagaccacagcaaaccaagatcctctagaggctacaacggggatgata
cctctcctcggagtagatgtgtgggagcatgcgtactatctccagtataaaaatgcaaga
ttggattatttaaagaattttccaagtataattaactgggattatatagagagtcgtttt
gtagaaatgagtaagtaa

DBGET integrated database retrieval system