KEGG   Callorhinchus milii (elephant shark): 103184569Help
Entry
103184569         CDS       T03088                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII A chain
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
Enzymes [BR:cmk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103184569 (f13a1)
Cell adhesion molecules and their ligands [BR:cmk04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     103184569 (f13a1)
   VLA-9
     103184569 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 103184569
NCBI-ProteinID: XP_007900853
LinkDB All DBs
Position
Un
AA seq 734 aa AA seqDB search
MSEPSGADSNTRPSTSHVGRRITPSNISNGEENSMPDFEFFGAVPRSPPNLTDFLTVWSV
DVLPGTDDINKKQHRTNLYESDNLIVRRGQSFEIRISFNRPYVQGKDKFWVEFLIGRYPN
ITKGTYIPIYLEEQLEQGKWGAKIMTTWQNTLSLSIMSPAYCPVGRFRMYVAIMTPYGIR
RTARDSDTDLYILFNPWCSDDAVYMDTEAEKEEYILNDIGHLYYGEASEVVSRAWIFGQF
ESGVLDSCLYALDRARMPLQARGCPIKVCRVASAVINSLDEDGILVGSWTGAYGDGVAPT
AWNSSVDILLQYFRTRQPVRYGQCWVFAAVFNTVLRCLGIPSRVITNYSSAHDNDGDLVT
DVILDENGKKDLEFTKDSIWNYHCWNECWMSRADLPPGYGGWQAVDATPQETSGGMFRCG
PASVLAIKHGQVFFPFDAPYIYAEVNSDVIYWTRHKDGTLTKADVKTDQVGKLILTQKIG
TELEENITEQYKFPEGSSNDKRAQESAIQYGVKKEKKVIAKPMDVSLRVQVEEKILIGTG
FVISLEFKNNSDEKRTVTVQLSGSVDFYTGVPNSNFIDQTLKVFVEPHQVQQAQVKIKPK
DYVNRLVEQSTLSFLITGRVKENEQILVAKKIIALQIPMLRMKVEGPTQFGREVNLVTEF
TNPLKQNLENVVLRLEGLGLLKPKIKFFSIILQNGTLTTSDVFVPWKHGPRKLVASLDCN
LLRQVVGELWLTII
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacccagcggtgctgactcgaacacgaggccctcgacttcacatgttggtcgt
aggatcaccccctccaacatctccaatggcgaggagaattcaatgccagactttgagttc
tttggggctgttcccagatcaccacccaatcttacagattttctgactgtttggagtgtt
gatgtcctcccgggtaccgatgacatcaacaagaagcagcatcgcaccaatctgtatgag
tccgacaacctaatcgtacggcggggccaaagcttcgaaatcagaattagtttcaaccgc
ccctacgttcagggaaaggacaagttctgggtcgagttcttgataggtcggtacccaaat
atcaccaaaggaacctacatccccatttacttggaagaacagctggagcaaggaaaatgg
ggagcaaaaataatgaccacctggcaaaacaccctcagtctttcaatcatgtcccctgct
tactgtcctgttggacgattcagaatgtacgtagctataatgacaccatatgggatccgc
agaacagctagagattcagacacagatctctacattctcttcaatccttggtgttcagat
gatgcagtctacatggacactgaggcggagaaagaagaatacatcttaaacgatattggt
cacctttactatggagaggcctctgaagtggtctctagagcttggatttttggtcagttt
gaaagtggtgtattggactcttgcctatatgcactggacagggcacggatgcctctgcaa
gcaagaggatgcccgatcaaagtttgtcgtgttgcgtctgcagtgattaattctctggac
gaagatggtatccttgttggaagttggacaggtgcttatggtgatggagtggcccccaca
gcttggaacagcagtgtcgatattttgttacaatatttccgcacaagacagccagtgcgt
tacggacagtgctgggtctttgctgcagtattcaatacggttcttcgctgcttgggaatc
ccttcgagagttatcactaactattcctcagctcatgataatgatggtgacttggtgact
gacgtgattcttgacgaaaatggaaagaaggatttagagttcacaaaggattcaatctgg
aattaccattgctggaatgaatgttggatgagcagagcagatcttccgcctggttatggt
ggatggcaagcggtcgatgccacacctcaagaaactagtggaggcatgtttaggtgtggg
ccagcatctgttctcgccataaaacatggtcaagttttctttccattcgatgctccttac
atttatgctgaggtaaacagcgatgtaatctattggactagacataaggatgggaccttg
actaaagctgatgtaaagactgatcaggttggaaaattaattttgacacagaagattggg
actgaattagaggaaaacatcacagagcagtataagttcccagaaggcagcagtaatgac
aaaagggcacaggagtcggcaatacagtatggtgttaaaaaggagaaaaaagtaattgcc
aagccgatggatgtatcactgcgtgtgcaggtggaagaaaagattttaattggcacaggt
tttgtcatcagtttggaattcaaaaacaacagtgatgaaaagagaactgttactgttcaa
ctcagtggcagtgttgacttctacacaggagtcccaaactccaattttatagatcagaca
ctcaaagtgtttgtggagcctcatcaggtgcaacaggcacaagtgaaaatcaaaccaaag
gattatgtgaatcgccttgttgaacagtctaccctgagcttcctcatcactggacgtgtg
aaagaaaatgaacagattcttgttgccaagaaaattatagctctgcagatcccaatgtta
aggatgaaggtcgaaggaccgacacagtttggcagggaggtaaacctagtgactgaattt
acaaaccctctcaaacaaaatctggagaatgtggttctgcgcctcgagggcttgggcttg
ttgaagccaaagataaagtttttcagtatcatccttcagaatgggactctgaccactagt
gacgtctttgtgccatggaagcatggtccccggaagctggttgctagcctggactgtaac
ttgctgagacaggttgttggagagttatggctaaccattatttag

DBGET integrated database retrieval system