KEGG   Callorhinchus milii (elephant shark): 103184666Help
Entry
103184666         CDS       T03088                                 

Gene name
ptgs1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00590  Arachidonic acid metabolism
cmk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103184666 (ptgs1)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103184666 (ptgs1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 103184666
NCBI-ProteinID: XP_007901005
UniProt: V9KFA2
LinkDB All DBs
Position
Un
AA seq 597 aa AA seqDB search
MEAERLLRSMLFILGLCSVKTSQTSASVNPCCYFPCQNKAVCVTVSEVSYECDCTRTGYY
GVNCTSPDFWMRIQIFLKPNPNFTHYILTRFQWFWNIINNIPFIRDKIMQLVLTVRGNLI
PSPPTYNSDAGYLSWEAYFNLSYYTRLLPPVPKGCPTPLGTRGNKEFPDAKLLAEKFLLR
KKFIPNVRGSNLMFAFFAQHFTHQFFRTDFNRGPGFTKALGHGVDLSHIYGDTLERQHQL
RLFKDGKLRYQVVKGDVYLPSVEAVPIKMKYPRTVPSSSQFAIGQDLFGLIPGLMMYATI
WLREHNRVCDILKQEHPTWGDEQLFQTARLVLLGETIKIVIEDYVQHLSGYYFKLTFNPE
LLFHGNFQYQNRIAVEFNHLYHWHPLMPDTFLVQGNEFSYEDFLFNTSVLLEYGLEGLVE
SFSKQKAGQIGGGKNIHHKVLHVAIRVIEQGRQLRFQSFNEYRKRFDLVPYTSFQQLTGE
TEMAGELEALYGDIDALEFYPGLLLEIPQENALFGESMVEMGAPFSLKGLMGNPLCSPQY
WKPSTFGGKTGFDIVNTASIEKLVCLNLKRCPYVAFQVPDTVDGELEMKEREPSSEL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggagcggctcctcaggtccatgttgtttattttggggctgtgttcggtgaag
acaagtcagacctcagcatcagtgaatccctgctgttacttcccgtgtcagaacaaggcc
gtgtgcgtcactgtcagtgaagtcagctatgagtgcgattgcacgcggaccggttactat
ggagttaactgcacgtcgcctgatttctggatgaggatccagatcttcctgaagccgaat
cccaactttacccattacatcctgactcggttccaatggttctggaatattatcaataac
atcccgttcatcagggacaagatcatgcagctggtgttaacagtgcgggggaacctgatc
cccagccctcccacctacaactcagacgccgggtacctcagttgggaagcgtatttcaat
cttagctactacactcggttactcccaccagtgccgaagggatgtccaactccgcttggg
acacgaggaaacaaggagtttcctgacgcgaaacttctagccgagaagtttctgttgcgg
aagaagtttattccaaatgttcgagggtccaacctgatgtttgcgttcttcgcccagcac
ttcacccaccagttcttcaggacggattttaaccgaggccctgggttcaccaaggctctt
ggccacggggtggatctgagccacatctacggagacaccctggagaggcagcaccaactg
aggctgttcaaagatggcaagctccgatatcaggtggtgaagggagatgtctacctaccc
tccgtggaagccgtgcccatcaaaatgaagtacccgaggacggtgccatccagcagccag
tttgctattggccaggacctgttcggcctgatcccgggtctgatgatgtacgctaccatc
tggctacgggagcacaacagagtctgcgacatcctgaaacaggagcatcccacctggggc
gatgagcagctcttccagactgccaggctcgtgctcctaggggaaaccatcaaaatagtc
attgaagactatgtccagcatttgagtggttattacttcaagttgacgtttaaccctgag
ctgctgtttcatgggaatttccagtaccaaaaccggattgcggtggagttcaatcacctg
tatcactggcacccgctcatgcctgacaccttcctcgtacaaggcaatgagttcagctac
gaagactttctattcaacacctcggtcctgcttgagtacgggctggagggcttagtggag
tcgtttagcaaacagaaggcaggtcagattggtggaggcaagaatatccaccacaaggtc
ctgcatgtggcaatcagagtcatcgagcaaggaagacaactgcggtttcagtccttcaat
gaatacagaaagaggtttgacctggtgccctacacatccttccagcaactgacaggggaa
acggaaatggcgggggagctggaggcactgtatggtgacattgacgctttggaattttac
cctgggctcctgttggaaattccgcaggaaaacgcattattcggggaaagcatggtggaa
atgggggctcccttctccctcaaggggctgatgggaaatcctctctgttctccccaatat
tggaagccaagtacgttcggagggaagacgggatttgacatcgtcaacacggcatccatt
gagaagctggtttgtctcaacctaaagaggtgtccttacgtggctttccaggtgcccgac
actgtagacggtgaactggagatgaaggaaagggagccttcgtccgagctgtag

DBGET integrated database retrieval system