KEGG   Callorhinchus milii (elephant shark): 103185837Help
Entry
103185837         CDS       T03088                                 

Gene name
hk1
Definition
(RefSeq) hexokinase 1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103185837 (hk1)
   00051 Fructose and mannose metabolism
    103185837 (hk1)
   00052 Galactose metabolism
    103185837 (hk1)
   00500 Starch and sucrose metabolism
    103185837 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    103185837 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103185837 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103185837 (hk1)
Enzymes [BR:cmk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103185837 (hk1)
Membrane trafficking [BR:cmk04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103185837 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 916 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYGARLSDETLCEIMGRFRTEMEKGLGRDTHPTAT
LKMLPTFVRSTPDGTEKGDFLALDLGGSNFRILRVKVSHERQQRVEMESKIYSTPKDIVH
GSGAQLFDHVAECLGEFLEKQEIKDKKLPLGFTFSFPCRQTKLDESILITWTKGFKASGV
EGSDVVKLLRKAIDKRGEYDVDIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNCCYME
ELRHIDLVEGDEGRMCINIEWGGFGDDGSLEHIRTEFDREIDRGSLNPGKQMFEKLISGM
YMGELVRLILVKMAKEGLLFEGRITPELLTKGKLQTKDVSAMEKTKEGLLRAKEVLSRLG
LEPSDEDCIGVRHVCTIISFRSANLCAAALGAILSRLKDNKGVPRLRTTVGVDGSLYKMH
PQFARRLQKTVRRLLPDCEVRFLLSESGSGKGAAMVTAVATRLVSQRQEMDQTLASFTLT
REQLFEVKRRMRVEMENGLKKKTHEAATVKMLPSFVRSIPDGSENGDFVALDLGGTNFRV
LLVKIRSGKRRTVEMHNKIYAIPLEIMQGTGEELFDHIVTCISDFLDYMGMKGARLPLGF
TFSFPCEQKSLDEGILLKWTKGFKATDCEGEDVVSMLRDAIKRRDEFELDIVAVVNDTVG
TMMTCAYEDPQCEVGMIVGTGSNTCYMEEMGNVEMVGEEEGRMCVNMEWGAFGDNGCLDD
IRTEYDRAVDDLSLNQGKQRYEKMISGMYLGEIVRNVVIDFTRRGFLFRGQISERLKTRS
IFETKFLSQIESDRLALLQVRAILQQLGLDSTCDDSIIVKEVCGAVSCRAAQLCGAGMAA
VVDKIRENRRLDHLEVTVGVDGTLYKLHPHFSKIMHKTVKELAPKCNVTFLLSEDGSGKG
AALITAVACRLRECGQ
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgatagctgcgcagctcctggcctattacttcacggaattaaaggatgatcaagtgaaa
aagattgacaagtatctttacggagcccgtctgtcagatgagacgctgtgtgaaatcatg
ggccgtttccgaacggagatggagaagggtttgggtcgagacacccaccccacagccacc
ctgaaaatgttaccaaccttcgtcaggtccaccccagatggaacagagaagggagatttc
ctcgccctggacctgggtggctcgaatttccgtatcctccgagtgaaggtgtctcacgag
cgtcagcagcgggtggagatggagagcaaaatctacagcacgcccaaggacatcgtccat
ggcagcggcgcccagctgtttgaccatgtggctgaatgcctgggagagtttctggagaaa
caagagattaaggacaagaaactgcctctgggctttaccttctcctttccctgcagacag
accaagctggacgagagtatcctgatcacgtggacgaagggtttcaaggcgagcggagtg
gagggctctgatgtggtaaagctgcttcgaaaggcgatcgacaagcgaggggagtatgat
gtggatattatggccgtggtgaatgacacagtgggcactatgatgacctgtggctttgac
gaccagcgctgtgaagtggggctgatcattggtactggtactaactgctgttacatggag
gagctgcggcacattgacctggtggagggggacgagggccgcatgtgcatcaacatcgag
tggggggggttcggggacgacggctccctggagcacatcaggactgagtttgaccgggag
attgatcgcgggtctctcaaccccggcaaacagatgtttgagaagctgatcagtgggatg
tatatgggagagctggtgaggcttatcctagtcaagatggcgaaggaagggctgctgttt
gagggtagaatcacgcccgagcttctgactaaaggcaaactacaaaccaaggatgtgtcc
gccatggagaagaccaaggagggtttgctgagggcgaaggaggtgctgagccgcttgggg
ctggagccctcagacgaggactgtattggggtgaggcacgtgtgcaccatcatctccttc
cgctccgccaacctgtgtgccgccgcgctcggcgccatcctctcccgcctcaaggataac
aagggcgtcccccggctccgcaccaccgtgggcgtggacggctcgctctacaagatgcac
ccgcagtttgcccggcgtctccagaagacggtcaggcggctgttgccggactgcgaggtg
cgattcctgttgtcggagagcggcagtgggaagggggcggccatggtgactgcagtggcc
acccggctggtgtcccagcgccaggagatggaccagacactagcctccttcaccctgacc
agggagcagctgtttgaggtgaagcggaggatgcgggtggagatggagaacgggctgaag
aagaaaacgcacgaggcggccaccgttaaaatgctgccctccttcgtccgcagcatacct
gatggctcagagaatggagactttgtggccctggacctgggaggcactaacttccgggtg
ctgctggtcaagatccgcagcggcaagcggcgcaccgtggagatgcacaacaagatctac
gccatccccttagagatcatgcagggcaccggagaagagctcttcgatcacattgtcaca
tgcatctccgacttcctggattacatgggcatgaaaggagctcgtcttcctcttggcttc
accttctccttcccctgtgagcagaagagcttagacgaggggattttgctgaaatggacc
aagggattcaaggccacggactgtgagggggaagatgtggtgtccatgctgagagacgcc
atcaaacgccgggacgaatttgagctggacattgtggctgttgtgaacgacacggttggg
acgatgatgacctgcgcttacgaggatccgcagtgtgaggtcggcatgatcgtagggacg
ggcagtaacacctgctacatggaggagatggggaacgtggagatggtgggcgaggaggag
ggcaggatgtgtgtaaacatggaatggggggccttcggggacaatggctgcctggacgat
atccggacagagtacgaccgagctgtggatgatctgtctttgaaccaaggcaaacagaga
tatgagaaaatgatcagtggcatgtacctgggcgaaatagtgcgtaacgtagtgattgat
ttcacccggcgaggcttcctgttccgaggtcagatctccgagagactaaagaccagaagc
atcttcgagaccaagttcctgtcacagatagaaagtgaccgactggctctgctccaggtg
agagccatcctgcagcagctgggcttggacagcacgtgtgatgacagtattattgtgaag
gaggtgtgtggggctgtgtcctgccgagcggcacagctgtgcggggcaggaatggctgcc
gtcgtggacaaaatccgggagaacaggcgcctggatcacctggaggtcacggtgggcgtg
gacgggactctctacaaactgcacccacatttctcaaagatcatgcacaaaacagtgaag
gagctggctcccaagtgcaacgtgaccttcctgctgtctgaggacggcagtggaaaaggt
gctgcgctgatcactgcggtggcctgcagactgcgggagtgtggccagtga

DBGET integrated database retrieval system