KEGG   Callorhinchus milii (elephant shark): 103190896Help
Entry
103190896         CDS       T03088                                 

Gene name
setd2
Definition
(RefSeq) SET domain containing 2
  KO
K11423  
histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103190896 (setd2)
Enzymes [BR:cmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103190896 (setd2)
Chromosome [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103190896 (setd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 2811 aa AA seqDB search
MSPGSLGVQSTGEMGEDDITVKSDNASTQNALKGSAVTKGCSRFLPKGTKAKVNLEDQGR
QKVSFTFNVTKTLRNRFQSAIGAEQDEVKIPPLALTLSSGRGSQDSKSDSDSAGATEPSS
SPPKAKVEWNKMHFKKKHLNDAAKPDKTLDRQPSSSLCEAVVEVAVKKDICNSSGETEPE
AQIIAEPQPQSDQNSGTSHIGKDDTAEEFKIVSPESDNLRKSSQSEGVAPGHLAGSESEA
DLLRTSPARKSQEPDRDVKKNASLSKPEEVEKVSSHSKSDRDKRSAGHSKSDRDSRRISS
RSKYDREERISSSRSRSDRDLRTSSYSKSDRSRASYYRDKDRGYRRSSPYSERSKSSRSK
LATDLREGSSFSDSEDESRRYHSKSHDLRRTSMHSKSYRDSRKYQSKLDRELRATSSCSE
SERETRRTKPQSKSGKLSRTRSYESEIVKMNSPEPDLDSRKSSKSDGYSKVTSSHSKSGS
CCESEIIQTNSPEPDLESGKSSKSDGYSRITPIHPKLVTSCETHINVKSSAPPVLEYRKS
YRHDSNSRTAPSHSQACEIEAVSTDSPELDSNRNDKPDSNFRTALPHCKSSTSFVTEVIK
KESPESELDSGRSDKCDTNLPTPPPDPRPDTFSEMEAVDIDSSDRELELRKDSLHSNSVR
TATHCKAFSSPQEEAVRMDCSESDSKRSAKRNISLVTPESPSTSPAGYEIDVVQTDSTES
KLDSLKSIQSDMNLRTIQSRSKSPICCGMDLVRVAPPEAESESWERCKLDSISVIASSNS
EPQEMRISAPHTPGMVLRGGPLGLESEEEFREPPESAAMPIVTTSEECCFSFHHKMDRSV
STSSCSTPDRLRHFCHSNVEVQISGDSPSSKLGVVMKSSACSGSGEDLTFSPHCKLDLKT
SPHSLLSEVPSSARLMFSDLKPSAHSNPRERESSSLPMLVESRTSHMVTEEEFSPCPEVK
ESMPIPGGAQFTSTNSKLSTWLTKHIDGHSVDARHPHNQRERRASTSEGDEASVAESAGA
SYEVVDVSSFNHCSSKLHVVPADQNWDSLDKERLYTDSMISEGKQLSNVEMESPAYSMEN
EETPFSTRPDSSVKVELEEDMELSDIEDEQESEIVTEAAEPLSTTKFADSEDAECSLPNY
QTKSNCDSSCMKAEYNSISSDNENYLEDAKSNSDEDSEESNTSTDSEDDRGIPRNRLQSV
VVVPKNSSLTMEEKSPSASSSSSPRRGRGDKKRPKAEEGGRCEVKETPASERQASSFQME
RIPLESSDNQNRSGALPTPESHPHTSSGNLTPVRESHDGVKQELLTDTADSTSQPENFSS
DRNQLAASQEKSDSTEAPVDKYQWLSGHTASHPAAQSSTQHLYRVERDPRETPDSRQMDK
WSQQHSQERPYFHSSEYVDSFDWEFAQPEKPSSSCQQPDSSYGLYKRHSSRTEETDTGDG
CGYCHNNAASSWDPKDISEPTLGKFSNYRLGQVVSGSDVQGQVQPDSMTDYFESREAVNH
GGSRSGSKGVSSLQAHEITSNSSKGTTLLLKASDSTINKDPRTKSLDKRPDSEPQKQQPE
PGVDTDSESDAEPRECEQVTEPDPEPEPEPEPDASELYREWVALVCKMEEFRCSQWWKDQ
SKSGVMPPYFELIDENLYLTERKKSKSHRDIKRMQCECMLSKEDRERGVLACGEDCLNRL
LMIECSSRCLHGEFCTNRRFQRRQYADVEVILTERKGWGLRAAKELPVNCFVLEYCGEVL
DHREFKARVKEYARNKNIHYYFMALKNDEIIDATLKGNCSRFMNHSCEPNCETQKWTVNG
QLRVGFFTTKAVPPGTELTFDYQFQRYGKEAQKCFCGSANCRGFLGGENRVSIRAAGGKV
KLKDKERSRKKDSVDEELEALLENGKGLSDPNQVLSLTRLMVRIETMEQKLTCLQIIQDT
HSQACLKSFLEYHGLSLLWIWMTELGDGRGNSSNNIKLQTQMMKTLEILPISTKNMLEES
KLLPIVQRWAQPKASAPQPSEADGYSSENTSRAQTPLNTQEAGPKPGAEPEGDTPRKLVM
RRLKIISENSMDSALSDTSKASDGEIEAKEGKEDTEPSQGPAPTEDEQPIALGAGEGQAE
LGAGEGNTGERAMEGTGGSQAVEGAAEGQAGEVVEGAQTGEGVGEAKAGPGAGETKVGLG
AGGSQAELGASGSQPDSREALEQESLPKTSNGPKLEESVLTGTPSQDEEEGLSDAESERS
HEQHCKMEDVSDLATKLLENWKDLKEVYRIPKKDRSQAERDSTERGRDGSSQKDLSQTPK
TPSSSSKEKDTDKPALSKDRKKRKQTASPPPSAYEREGLKRLSADERYDTTTPSKKKKTR
SKLTTEERRKLFEQEVAQREAQKHGLYIQQQPMCGSSQVPYDTAAYTNSHLNFVSYPPGY
PLQAYVDPVNPNAGKVLLPTPNVELVCQALSYDQQLLAEPMPAGQHAVPTVQHLSPQVDI
QTQQYLTPAPSVLPQDPSLAVLQVTATQAPAQNYTLWDPNQQALAVHQQYSSGQPQASIY
YQGQPCQPVYSISSSYGQTSQPIVQTYAQSSPEYTQGQQAFIVQPSAGVLVTSPAPAYQP
TGQPQAVQQQELMVVSSLLDLPPPSPPKAKSIVLPSNWKTARDPEGKIYYYHVVTRQTQW
DPPLWEGGNDDTSMGHEAEMDLGTPTYDENPAKDPMLADLHGLDGSADGTPNAYSLSSKK
KAKTAEADTSSELAKRSKELFRKEISQFIVLCLNPYRKPDCKIGRIVATEDFKHLARKLT
HGVMNKELKQCKNPEDLECNENVKHKTKEYIKKYMQKFGATYKPKEEPDME
NT seq 8436 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccgggctcgctgggcgtgcagtccacaggagagatgggagaagacgatattacg
gtcaaaagtgataacgcaagcacccaaaatgccctcaaaggatctgctgtgacaaagggc
tgcagccggttcttacctaaaggcaccaaggcgaaagtcaaccttgaggatcaagggcgg
cagaaggtttctttcaccttcaatgtcacaaagactttacggaatagattccagagtgcc
ataggggctgaacaagatgaggtcaaaattccccctctggcgttgactttgagctctggc
agaggaagccaagacagtaagagtgactctgactctgcaggggcaacggagccgtctagc
tcgccccccaaggccaaggtggagtggaacaagatgcacttcaaaaagaagcacctcaac
gatgcagccaaacctgacaagacgttggacagacagccttccagttcgctgtgtgaggca
gtggtggaggtggcggttaagaaagacatctgtaattcttcaggggaaactgagcctgag
gcgcagatcattgctgagcctcaaccacagtcggatcaaaattccgggacatcccacatt
gggaaagatgatactgcggaggagttcaagatcgtgtctcctgagagcgataatcttagg
aagtcctctcagtcagagggagtagcgccaggtcatttagctggttcagaatctgaggca
gatttgctccggacgtcgcccgctcgcaaatcgcaggaacctgatcgcgatgttaagaaa
aacgcatcactttccaaaccagaggaggtggaaaaggtttcctctcactcaaagtcggac
cgagataagaggagcgccggtcattccaaatctgatcgagattcaaggaggatttcatca
cgctcaaagtatgatcgagaggagaggatcagttcgtcgcgctcacgctctgatagagac
ttaaggacctcgtcctattccaagtcagaccggtcaagagcttcttattatcgtgacaag
gaccgagggtaccgcagatcctcgccttactctgagagaagcaagtcgtcccgttccaaa
ctggccacagatttaagagaaggatcctcattttcagattctgaggatgaatctaggcgg
tatcattccaaatcacatgatttaagaaggacatcaatgcattctaaatcctacagggat
tcaaggaaatatcagtcaaagctggacagagagttgagggcaacctcgtcctgctctgaa
tcagaaagggagacaagaaggactaaacctcagtctaaatcaggcaaactatccagaact
cgttcttatgaatccgaaattgtgaaaatgaattctcctgagccagacttggattctcgg
aaaagttcaaagtctgatggttattcgaaggtaacttcatctcattcaaagtcaggttcc
tgttgtgaatccgaaataattcaaaccaattcccctgagccagatttagaatctgggaaa
agttctaagtctgacggttactcaaggataacaccaattcatcccaagttggtcacctct
tgtgaaacgcatataaatgtaaagagctcagctccgccggttctggagtacaggaaaagt
taccggcatgacagtaattcaaggacagctccgtctcattctcaggcttgtgaaatagag
gccgttagtacagattctccagaattagattctaacagaaatgacaagccggacagtaat
tttaggacagctttgcctcattgcaagtcatctacttcttttgtaactgaagtcatcaag
aaggagtccccagaatcggaattagactctggcaggagtgataagtgtgacacaaatttg
ccgaccccaccacctgatcccaggccagacacttttagtgaaatggaagcagttgacatt
gactcttctgatcgcgagttagaattgcggaaagattctctgcacagtaactcagtgagg
acggcaactcactgcaaggccttctcgtctcctcaagaggaggcagttagaatggactgt
tctgaatctgattcgaagagaagtgccaaaagaaacatcagtttggtgacgcctgaatct
ccctccacatcccctgctggctatgaaatagatgtagtccaaacagactcaacagaatcc
aagttggattcattaaaaagtattcaatctgacatgaatttgaggacaattcaatccaga
tcaaagtcgcccatctgctgtggcatggacttagttagagtggcccctcctgaagcagag
tcggaatcctgggaaaggtgcaagttggacagtatttcagtgatcgcttcttctaattct
gagccccaggagatgaggatctcagcccctcacacaccgggaatggttttgcggggagga
cccttggggctggaatcggaagaagaattcagagagcctcccgagtcggcagcaatgccg
attgttaccacctcagaggaatgttgtttttcctttcatcacaagatggacaggagtgtc
agtacctcctcgtgttccacgccagacagattgagacacttctgccattccaacgtcgag
gttcaaatctcaggggattcgccaagttcaaagctgggcgttgtgatgaagagttcagcc
tgctccggatcgggcgaggacttgaccttttcgcctcattgcaaactggatttgaagaca
tcacctcattccttgctaagtgaggtgccgtcttcagctcgtctcatgttcagcgatttg
aaaccctcggctcattccaacccccgtgagagagagtcgtcatccctccccatgctggtg
gagagcagaacttcacacatggtgacagaagaggagttttcaccatgtcctgaagtgaag
gagtctatgcccataccgggtggtgcacaattcacttcaactaactctaaactttccaca
tggctcacaaagcacatcgatgggcactcagttgatgctcggcatccacataatcaaagg
gaacgacgcgcaagtaccagtgaaggagacgaagcttctgtggcagaatctgcgggagct
agttatgaggtggttgatgtaagtagctttaatcactgcagcagtaagttacatgtggtg
cctgctgatcagaactgggattcgttagacaaagagaggttgtacactgactccatgatc
tcggagggcaagcagctctctaatgtggagatggaaagtccagcttactcgatggaaaat
gaagagacgcctttttccaccagaccggacagttcggttaaagtggaacttgaggaggat
atggaactttctgacattgaggatgagcaggagagtgagatagtgacggaggcggcagag
ccgttgagtactactaaatttgcagactcagaggacgcggaatgcagtttacctaattac
caaaccaagtctaactgtgatagcagttgcatgaaggctgagtacaacagcattagctcg
gataatgaaaactatttggaagatgcaaaaagtaatagtgatgaggatagtgaagagagc
aacacgagtacagattctgaggacgaccgtggaattcccaggaatcgcttgcaatctgtt
gttgtcgttcccaagaattcatcattaacaatggaagagaagagcccctcagcgtcctca
tcgtcctctccccgacgtgggagaggtgacaagaaacgtccaaaggccgaggaaggtggc
aggtgtgaagtgaaagagacacctgccagtgaacgtcaggccagcagttttcagatggaa
cgcatacctctggagagcagcgataaccaaaaccgcagtggggctctgccaaccccggaa
agccaccctcacacgtcttctggtaatcttacaccggtgagggagagccacgatggtgtc
aagcaagagctgctcactgacactgcagacagcaccagtcagcctgagaacttctcatca
gacaggaaccaactcgctgcctcacaagagaaatcagactccacagaggctcctgtggac
aagtatcagtggctgtccggtcacacggccagccatccagcagcacagagcagtacacag
catctgtacagggtcgagagagacccgagagaaacaccagacagcagacagatggacaag
tggtcacaacagcacagccaagagcgcccgtattttcacagctcggaatatgtggatagc
tttgactgggaatttgctcagccagagaagccaagcagtagttgtcagcaaccagacagc
agttatgggctatacaagagacatagctccagaacagaggaaactgatacaggggatgga
tgtggttactgtcacaataatgcagccagctcctgggatcccaaggacatctctgaaccc
acattgggcaaatttagcaattatcgtttgggtcaagttgtgtctggctcagatgttcaa
gggcaggtccagccagactcgatgaccgattactttgagagtagggaggctgtaaaccac
ggcggctcaagatctggctcaaaaggtgtgagctctctgcaagctcatgagatcaccagc
aactccagcaaagggaccaccttgttgcttaaagctagcgattccactataaacaaagac
ccaagaaccaaaagcttggataaacggcctgacagtgagccccagaaacagcagccagaa
cctggggtggacactgattccgagagtgatgctgagccaagagagtgtgagcaagttact
gagcccgaccctgaacccgaacctgagcccgaacccgatgcctccgagctttacagagag
tgggttgctctggtgtgtaaaatggaggagttcagatgctcccagtggtggaaggatcaa
tccaagtcgggggtaatgcctccttactttgagttgattgacgagaacctgtacttgaca
gagaggaagaagagtaaatcgcaccgtgatatcaaacgcatgcagtgcgagtgcatgctt
tccaaggaggatcgagagcgcggggtgcttgcgtgcggggaggactgtctgaacaggttg
ctcatgatcgagtgctcctccaggtgtctgcacggagagttctgcacaaaccgccggttc
cagaggcggcagtatgccgacgtggaagtcattctaactgagaggaagggctggggcctg
cgagcagccaaagagctgccagtgaattgctttgtgctggagtactgtggcgaggtgctg
gatcacagggagttcaaagccagagtgaaggagtacgctcgcaacaagaacattcactat
tacttcatggcactgaagaacgacgagatcattgatgccactttgaaaggaaactgttcg
cgtttcatgaaccacagctgtgaaccgaactgtgagactcagaagtggacggtgaatggg
cagctgagagtgggctttttcaccaccaaggccgtgccacctggcacagagctgaccttc
gactatcagtttcagagatacgggaaggaggcacagaaatgtttctgtggatcagcaaac
tgccggggcttcctcgggggtgaaaaccgggtcagcattcgggccgcaggaggcaaggtc
aagctgaaagataaagaacggtcccgcaagaaagattctgtggacgaggagctggaggcc
ctgctggagaacgggaagggcctgtccgatcccaaccaggtgctcagcctgaccaggctg
atggtgcggatagagaccatggaacagaagctgacctgcctccagatcatacaggacacg
cattctcaggcttgcctcaagtccttcctggagtaccatgggctgtccctcctgtggatc
tggatgactgagctcggagatggccggggaaactcgagcaacaatatcaaactgcagacg
cagatgatgaagacgctggagatcttgcccatctccaccaagaacatgctggaggagagc
aagctgctgcctatcgtccaacgctgggcccagcccaaggcctccgccccgcagcccagc
gaggccgacggatactccagcgagaacacgtcgcgggcacagacccccctgaacacacag
gaggccgggccgaagcctggggctgagcctgagggagacaccccgaggaagctggtgatg
cgcaggctgaagatcatcagtgagaacagcatggacagtgccctgtctgacactagcaag
gcctcggatggggaaatcgaggccaaggaggggaaggaggacacggagccctcacaaggt
ccggctcccactgaggatgagcagccaatagcactgggggctggggaaggtcaggctgag
ctgggggccggggagggcaatactggggagagggctatggaggggaccgggggatcccag
gctgtggaaggggctgcagagggccaggctggggaggtggttgagggagcccagactgga
gaaggggttggagaggccaaggcagggccgggagctggagagaccaaggtggggttgggg
gctgggggcagccaagcagagctgggggccagtgggagccagccagacagccgtgaagct
cttgagcaggagagtctcccaaagaccagcaatggccccaagttggaggagtcggtgctg
acgggaacgccatctcaggacgaggaggagggattgtcggacgcggagagtgagcgcagc
cacgagcagcactgcaaaatggaggacgtgagcgacctggccacaaagctgctggagaac
tggaaagacttgaaggaagtttaccggatcccgaagaaagaccggagccaagcggagcgc
gacagtactgagcgtgggcgagacggttcctcacagaaggacctttctcagacaccgaag
actccatcgagctcgagcaaagagaaggacacagacaagcctgcactcagtaaggatagg
aagaaacgcaagcagacggcatcccctcccccctccgcgtacgagagggagggactcaag
agactgtcggccgacgagaggtatgacacgaccacaccatccaagaagaagaaaacccgg
agcaagctcaccacggaggagcgacgcaagctgtttgagcaggaggtggcccagagggaa
gcccagaaacatgggctgtacatccaacagcagcccatgtgcgggagctcacaggtgcct
tatgacactgcagcctacaccaactctcacctgaactttgtcagctatccgccgggatac
cctttacaagcctacgtggaccccgtgaaccccaatgcgggcaaagtgcttctgcccacc
cccaacgtggagctggtgtgccaggcactcagctatgatcaacagctgctggcggaaccc
atgcccgcggggcagcacgctgtgcccactgtacagcatctctcacctcaggtggacatt
cagacacagcagtacctcaccccggcccccagcgtccttccccaggaccccagcctggcc
gtgctgcaggtcacagcaactcaagccccggcacagaactataccctgtgggaccccaac
cagcaggcactagccgtgcaccagcagtactccagcggccagccacaagcatccatctat
taccaggggcagccttgtcagcccgtctacagcatatcctcatcgtacggccagacctct
cagcccatcgtccagacttacgcccagtcgagtcccgagtacacacagggacagcaggct
ttcattgtgcagccgtcagcaggagtgctcgtcacatctccagccccggcctaccagcca
acagggcaaccccaggctgtccagcagcaggagctgatggttgtgagcagccttctggat
ttgccgcctccttcaccccccaaagcaaagtccatcgtcctcccctccaactggaaaact
gctcgagaccccgagggaaagatctactactatcacgttgtcaccagacaaacacagtgg
gaccccccgctgtgggaagggggcaacgacgacacaagcatgggccacgaggcggagatg
gacctggggacccccacttatgacgagaatccagccaaggacccgatgctggctgatcta
cacggactagatggcagcgcggacggtacacccaatgcttacagcctgtcttctaagaaa
aaggccaagactgcagaggcagacacatccagcgagctggccaagaggagtaaagagctg
ttcaggaaggagatctcccagttcattgttctgtgtctgaacccctaccgcaagcctgac
tgtaaaatcggcagaatcgtggcgacagaagacttcaaacatctggcccgaaagttgact
catggagtcatgaacaaggaactcaaacagtgtaagaacccagaggacctggagtgcaat
gagaatgtcaagcacaaaaccaaggaatacatcaaaaagtacatgcaaaagttcggagcc
acctacaaaccgaaagaggagcccgacatggaataa

DBGET integrated database retrieval system