KEGG   Corynebacterium marinum: B840_02150Help
Entry
B840_02150        CDS       T03633                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cmq  Corynebacterium marinum
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cmq00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    B840_02150 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    B840_02150 (alr)
Enzymes [BR:cmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     B840_02150 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cmq01011]
 Precursor biosynthesis
  Racemase
   B840_02150 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
428178..429284
Genome map
AA seq 368 aa AA seqDB search
MSPMDLLATRIDLDAIAHNTRLLKELVGDTQLMAVVKADGYGHGAGRVAEVMAANGADSF
GVATLREAVELRESGVGKPILAWIWSPEQDLVEALALRVQLGVPSLRHAQALVDAAVPAR
VTVKVDTGLHRSGVDETDWAEVFTLLRDAEHLTVTGLFSHLACADEPEHPANDEQAAAFR
RAIDLARGMGLDVPVNHLCNSPGTLTRPDLHHQLVRVGLAMYGLEPVAGLDHGLKPAMSW
VGRITVVKPIQPGESTSYGHTWTATEPGWLAVVPAGYADGVPRSWQGKLSVGIGGKLYPQ
VGRVCMDQIVVDLGANEFGVSPGDEAVLFGEGGMSADELAAATGTINYEIICTPAGRTAR
VYEGGVQL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccatggatcttctcgccacccgcatcgatctcgacgccatcgcccacaacacc
cgcctgctcaaggagctggtgggtgacacccagctcatggcggtagttaaggccgacgga
tacggccacggcgccggccgggtggcggaggtgatggccgccaacggtgccgacagtttc
ggcgtggccaccctgcgcgaggcggtcgagctgcgggagtcgggagtcggcaagcccatc
ctcgcctggatctggtccccggagcaggatctcgtggaggcgctcgcactccgcgtccag
ctcggcgtcccctcgctgcgccatgcacaggcgcttgtcgacgccgccgtccccgcccgc
gtcaccgtcaaggtcgacaccgggctgcaccgctccggggtcgacgaaacagactgggcg
gaggtgttcaccctgctgcgcgacgccgaacacctcaccgtcaccggcctgttctcccac
ctggcctgcgccgacgagccggagcacccggcgaacgacgagcaggccgccgctttccgg
cgggccatcgacctggcccgggggatgggcctggatgtgccggtcaaccacctgtgcaac
tcgcccggaaccctgacccgccccgacctgcaccaccagctcgtccgggtcggcctggcc
atgtacgggctcgagccggtcgctggcctggaccacggactcaaacccgcgatgagctgg
gtcgggcggatcacggtggtcaaacccatccagccgggcgaatccaccagctacgggcac
acctggaccgcgacggaaccgggctggctcgcggtcgtcccggccggctacgccgacgga
gtaccccgctcctggcagggaaaattgagtgtgggcatcggcggcaaactctatccgcag
gtcgggcgggtgtgcatggaccagatcgtggtggacctgggcgccaacgaattcggcgtc
tccccgggggatgaggccgtcctcttcggggagggcggcatgagcgccgacgagctcgcc
gccgccacgggcaccatcaactacgagatcatctgcaccccggccgggcgcaccgcccgc
gtctacgagggcggggtgcagctgtga

DBGET integrated database retrieval system