KEGG   Chelonia mydas (green sea turtle): 102930483Help
Entry
102930483         CDS       T02989                                 

Gene name
GPD2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    102930483 (GPD2)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     102930483 (GPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 EF-hand_6 FAD_binding_2 GIDA FAD_oxidored EF-hand_9 EF-hand_8 Pyr_redox_2 Pyr_redox_3 HI0933_like NAD_binding_8 EF-hand_5 Thi4 Pyr_redox FAD_binding_3 EF-hand_4
Motif
Other DBs
NCBI-GeneID: 102930483
NCBI-ProteinID: XP_007056735
UniProt: M7CDA7
LinkDB All DBs
Position
Un
AA seq 727 aa AA seqDB search
MAFRKVVKGTVLIGGGAIATVFGLSQFSQYRNKHGNFMYVQAAEPVNIPMKNHFPTREDQ
FLALQNTSEFDVLVIGGGATGCGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR
YLQKAIMRLDFEQYRMVKEALHERANLLEIAPHLSGPLPIMLPVYKWWQLPYYWVGIKLY
DLVAGSQCLKSSYVLSKSRALELFPMLRKDRLVGAIVYYDGQHNDARMNLAIALTAARYG
AATANYTEVVHLLKKTDPKSGKECVCGARCKDVLTGQEFDVKAKCVINATGPFTDSVRKM
DDQEVSNICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTVAGTTDTPTE
VTHHPIPTEEDINFILTEVRNYLSCDVEVRRGDVLAAWSGIRPLVTDPSSKDTQSISRNH
VVAVSDSGLVTIAGGKWTTYRSMAQDTIDAAIQAHNLKAGPCKTVGLFLQGAKDWSPTLY
IRLVQDYGLESEVAQHLASTYGDKAFEVAKIAQVTGKRWPIVGKRLVSEFPYIEAEVMYG
VKEYACTAVDMISRRTRLAFLNVQAADEALPRIIDIMGKELHWSEQKKKEELESAKKFLY
YEMGYKAKVGQLTDSSEITLIPSDIDRYKKRFHMFDKEKKGFITILDVQSVLESISIQID
ENTLHEILNEVDLNKNGQVELDEFLQLMSAIQKGYVSGSRLAVLMKTAEENLRERVVIPV
DRSGGGL
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atggcatttcgtaaggtagtaaaaggaactgttctcattggaggaggtgccatagcaaca
gtttttggcctctctcaattttctcagtatagaaacaaacacggtaactttatgtatgtt
caagcagcagaacctgtgaacataccaatgaaaaatcactttcctacaagagaagatcag
ttcctggctctacaaaacacaagcgaatttgatgtgcttgttataggaggaggagcaaca
ggatgcggctgtgcgttggacgctgttacgagaggactaaaaacagctcttgtagaaaga
gatgatttctcatcagggaccagcagcaggagcactaaattgatccatggtggagtgaga
tatcttcagaaggccatcatgaggttggatttcgagcagtacaggatggtaaaagaagca
cttcatgagcgggccaacttgcttgaaattgctcctcacttatctggtcctttgcctata
atgcttcctgtttacaaatggtggcagttgccatactactgggtgggaataaaactatat
gaccttgtagctggaagtcagtgtctgaaaagcagctatgtgctcagcaagtcaagagcc
ttggaactctttccaatgctacggaaagacaggcttgtaggagctattgtctactatgat
ggacaacacaacgatgcacgaatgaaccttgccatcgccctcactgctgccaggtatggt
gctgccacagccaattacactgaagtggtgcacttgctgaagaagacagatccaaagagc
gggaaggaatgtgtctgtggcgcacgatgcaaggatgttcttacagggcaggaatttgat
gtcaaagccaaatgtgttatcaatgctacaggacctttcacagactctgtgcgcaaaatg
gatgatcaggaagtatcaaacatctgtcagccaagtgcaggcgtgcatattgtgatgcct
ggttattacagccctgataacatggggctactcgacccagccactagtgacggacgagtg
attttcttcctgccatgggaaaagatgactgttgccggcaccacagacactccaaccgaa
gtcacacaccacccaatacctacagaggaagatattaactttattttgactgaagtgcgc
aactatctgagttgtgatgttgaagtgagaagaggagatgtcttggcagcatggagcggc
attcgtcctcttgtcacagatcccagctctaaagacacccagtcaatatctcggaatcat
gttgttgctgttagtgacagtggccttgttactatagcaggtgggaaatggacaacctat
cgctccatggcacaagataccattgatgcagccatccaggctcacaacctcaaggcaggt
ccatgtaagacggtaggacttttcctgcagggggctaaggactggagtcctactctttac
attaggctggtccaagattacggactggaaagtgaggtggctcagcaccttgcgtctaca
tatggtgacaaggcttttgaggtggccaaaatagcccaagttactggaaagaggtggcct
attgttggaaaacgccttgtatctgaatttccttatattgaagctgaggttatgtatggg
gtaaaagagtatgcatgcactgcagtggatatgatttcacgtcgcactcggctggccttc
ttgaacgtgcaagccgctgatgaagccttaccaagaattattgatataatggggaaggaa
cttcactggagtgaacagaagaaaaaggaagaacttgaatctgccaaaaagtttctgtat
tatgaaatgggctacaaggcaaaagtagggcaattaacagacagctctgaaatcactctt
ataccttcagatattgacagatataaaaagagattccacatgtttgataaagaaaagaaa
ggctttattaccatactggatgttcaaagtgtgttagagagcatcagcattcaaattgat
gaaaatacacttcacgagattttaaatgaagtggatttgaacaaaaatgggcaggttgaa
ctcgatgagtttttgcagctcatgagtgctattcagaaaggatatgtgtctggaagccga
ttggctgtacttatgaaaactgctgaagagaacctacgtgagagagttgttattccagtg
gatcgaagtggtggtggactgtga

DBGET integrated database retrieval system