KEGG   Chelonia mydas (green sea turtle): 102933336Help
Entry
102933336         CDS       T02989                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
cmy00590  Arachidonic acid metabolism
cmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    102933336 (PTGS1)
Enzymes [BR:cmy01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102933336 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 102933336
NCBI-ProteinID: XP_007061154
UniProt: M7BR72
LinkDB All DBs
Position
Un
AA seq 557 aa AA seqDB search
MRVGRESYECDCTRTGYFGTNCTWPEFWTRLHIMIKPSPAFYHFILTHFKWLWNILNNTF
IRDMLMRLVLTVRANLIPSPPTYNSVYGYISWEAHSNMSYFTRVLPPVPDDCPTPMGTSG
KKQLPDPQLFAERFLLRQRFQRDPQGTNLMFAFFAQHFTHQFFKTSGKMGHGFTKALGHG
VDLGHLYGDSLERQHQLRLFRDGKLKYQVVDGEMYPPTVLDAPVHMIYPPGTPKEKQLAV
GQEMFGLLPGLMMYATIWLREHNRVCDVLKQEHPTWSDEQLFQTTRLILIGETIKIVIED
YVQHLSGYFLHLKFDPELLFGMQFQYQNRIAVEFNQLYHWHALMPDSFTIQEDEYSYKQF
IYNTSMLLDYGVEALVESFSKQMAGQIGGGQTINTNLLKVAVGVIEESRLLRLQPFNEYR
KRFSMKPYKSFQELTGEEEKAAELEKLYGDINALEFYPGLLLEKCQPNSIFGESMVEIGA
PFSLKGLFGNPICSPEYWKPSTFGGSTGFEIVKTASLQKLVCLNVRRCPYVAFHVPDPST
ETGATGDHQDRKPSTEL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgagggtcggcagggaaagctatgaatgcgactgcacccggacaggttacttcggcact
aactgcacttggcctgagttttggacacgactccacattatgataaaaccaagcccggcc
ttctatcacttcatcctgactcacttcaagtggctttggaacatcctcaataacaccttc
attagggacatgctgatgagactggtgctaacagtccgggccaatctgatcccaagcccc
cccacgtacaactcagtgtatggatatatcagctgggaagcccattccaacatgagctat
ttcacccgggtccttccgccggtacccgatgactgtccgactcctatgggaaccagcggg
aagaagcagctccctgaccctcagctctttgcggagaggtttctgctccggcagcgattc
caaagggacccccaggggaccaacctgatgtttgccttcttcgcacagcacttcactcac
cagttcttcaagacatctgggaagatggggcatggattcaccaaggccctgggccatggg
gtggaccttgggcacctgtacggggacagcctggagcgtcagcaccagctgcggctcttc
agagatgggaagctcaaatatcaggtagtggatggagagatgtatccacccacggtcctc
gatgctccggttcacatgatctaccctcccggcactcccaaagagaagcaactggctgtg
ggccaggagatgttcggcctgctgccggggctcatgatgtatgcgaccatctggcttcgt
gagcacaaccgagtctgcgacgtgctgaagcaggagcatccaacgtggagcgacgagcag
ctcttccagacaacccgcctcatcctcatcggagagaccatcaagatcgtcattgaggac
tacgtgcagcatctcagcgggtacttcctgcacctgaagtttgacccggagctgctgttt
ggcatgcagttccagtaccagaaccggattgccgtggagttcaaccagctctaccactgg
cacgcgctgatgccggactcgttcaccatccaggaggatgaatacagctacaagcagttt
atttacaacacttccatgcttctggactatggggtggaggccctggtggagtctttctcc
aagcaaatggcaggacagattggtgggggacaaaccatcaataccaacctcttgaaagtg
gctgttggagttattgaggaatcacggctgctgaggctgcagccctttaatgagtaccgg
aagaggttttccatgaagccctacaaatccttccaggagttaacaggagaagaggagaaa
gcggcagagctggaaaagctatacggagacattaatgccttggagttttatcctggtttg
ttgcttgagaaatgccagccaaactctatttttggggagagtatggtggagattggagcc
ccgttttccctgaaagggcttttcggaaaccccatctgctctccagaatactggaagccc
agcactttcggcggctcgactggctttgagatcgtgaagacagcttcgctccagaagctc
gtgtgtctcaacgtcaggcggtgtccgtatgtggcattccacgtgccagatcctagcaca
gaaacaggagcaactggtgaccatcaagaccgcaaaccatccactgagctctag

DBGET integrated database retrieval system