Chelonia mydas (green sea turtle): 102946454 Help Entry 102946454         CDS       T02989                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism cmy  Chelonia mydas (green sea turtle) Pathway cmy04010   MAPK signaling pathway cmy04012   ErbB signaling pathway cmy04068   FoxO signaling pathway cmy04137   Mitophagy - animal cmy04140   Autophagy - animal cmy04144   Endocytosis cmy04150   mTOR signaling pathway cmy04210   Apoptosis cmy04218   Cellular senescence cmy04370   VEGF signaling pathway cmy04371   Apelin signaling pathway cmy04510   Focal adhesion cmy04540   Gap junction cmy04625   C-type lectin receptor signaling pathway cmy04810   Regulation of actin cytoskeleton cmy04910   Insulin signaling pathway cmy04912   GnRH signaling pathway cmy04916   Melanogenesis cmy05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cmy00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102946454 (HRAS)    04012 ErbB signaling pathway     102946454 (HRAS)    04370 VEGF signaling pathway     102946454 (HRAS)    04371 Apelin signaling pathway     102946454 (HRAS)    04068 FoxO signaling pathway     102946454 (HRAS)    04150 mTOR signaling pathway     102946454 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102946454 (HRAS)    04140 Autophagy - animal     102946454 (HRAS)    04137 Mitophagy - animal     102946454 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102946454 (HRAS)    04218 Cellular senescence     102946454 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102946454 (HRAS)    04540 Gap junction     102946454 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102946454 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102946454 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102946454 (HRAS)    04912 GnRH signaling pathway     102946454 (HRAS)    04916 Melanogenesis     102946454 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     102946454 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cmy04131]     102946454 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cmy04147]     102946454 (HRAS)    04031 GTP-binding proteins [BR:cmy04031]     102946454 (HRAS) Membrane trafficking [BR:cmy04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102946454 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102946454 (HRAS) Exosome [BR:cmy04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102946454 (HRAS)   Exosomal proteins of colorectal cancer cells    102946454 (HRAS) GTP-binding proteins [BR:cmy04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102946454 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  102946454 NCBI-ProteinID:  XP_037755482 LinkDB All DBs Position 6:complement(23519814..23594470) Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARNYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtataagctggtggtggttggagcaggtggcgttgggaagagcgctttgaca atacagctcattcagaaccattttgttgatgaatatgaccccacgatagaggattcctac agaaagcaggtagtcattgacggagagacctgtctgttagacatcttggacacggcgggt caagaggagtacagcgccatgcgagaccagtacatgcggacgggggagggcttcctgtgc gtctttgccattaacaatacaaaatcctttgaagatattcaccagtacagagagcagatc aagagagtgaaggattcagatgatgtccccatggtgctggtgggaaacaagtgtgacctt ccggcccggacagtggaaacccggcaagcgcaggacctggccaggaattacggaatcccc tacatagagacatcagcgaaaaccagacagggtgttgaagatgccttctataccttagtg cgggagatccggcagcacaaactacgcaagctgaatccgccggatgaaagtggcccaggc tgcatgaactgtaaatgtgtgatatcatga

DBGET integrated database retrieval system