KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBI3070Help
Entry
CNBI3070          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CNBI3070
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CNBI3070
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNBI3070
   00430 Taurine and hypotaurine metabolism
    CNBI3070
Enzymes [BR:cnb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CNBI3070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
9
AA seq 557 aa AA seqDB search
MALSQHVDADKLIEECKDHPIKRHLSHKAALYDIPYTSRYEVEDEVPRYRLPSKGVNGRA
TYQLLHDELMLDGNPNMNLASFVHTWVPDECNRLVQENINKNLVDQDEYPAAQQIHERCI
SMLSHLWHAPKEATAMGTATTGSSEAIMLGGLALKRRWQEKMKAAGKDIHNPGPNIVMGA
EAQVALEKFARYFEVEARLVPIKPESSYVMDPKDVLKYVDENTIGVFVILGSTYTGAFES
VKDVAQELDKYEAETGISVPIHVDAASGGFVAPFAYPHYQWDFQIPRVHSINASGHKYGM
STVGVGWIIWRSMEYLPKELIFELHYLGATDYSFNLNFSRPAHPILAQMFTFLNLGFEGY
KRIMDKNLTVARLISRALEHSGYFICLSKIHHPKALTESSSSAEQSNILPAVADAANTVL
HGKKTTVDDAEYYCEGLPVVSFMFTDEIKKKYPGVKQAWIQMQLRSIGWIVPNYPLAPDC
EKTEILRVVVRESLSGDLARKLIHDILQVTEDLLNDAGPSYSMSTATRRHENLDHGKLDN
IDAVHIKQHTSTYSKPC
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atggccctctctcaacacgtagacgccgacaagctcattgaagagtgcaaagaccaccct
atcaagaggcaccttagtcataaggctgctctttatgatattccctacacttcccgctac
gaagttgaggacgaggttccgagatacaggctccccagtaagggtgtcaatggcagggct
acataccagctcttacacgatgagctgatgcttgatgggaaccccaacatgaatttggct
tcatttgttcacacttgggttcctgatgagtgcaaccgtcttgtccaggaaaacatcaat
aagaatctggtcgaccaggacgaataccctgctgctcaacagattcacgagcgatgtatc
tcaatgctctctcacctctggcacgctcccaaagaagccacggctatgggcaccgctact
accggttcctctgaagccatcatgcttggcggtctcgctctcaagcgccgatggcaggaa
aagatgaaagccgctgggaaagatatccacaaccccggacctaacatcgttatgggtgca
gaggctcaagtagctttggagaagtttgctagatactttgaggttgaggcgagacttgtg
cctattaagcctgagtcgagttatgtaatggaccccaaggacgtcctcaaatacgtcgat
gagaacacaattggtgtctttgttatcttgggatcaacttacaccggcgcgtttgaatcc
gtaaaagacgtggctcaagagctcgacaaatacgaggccgagacaggtattagtgtccct
atccacgttgatgccgcttctggtggttttgttgctccatttgcataccctcattaccag
tgggacttccaaattcctcgagtccatagtatcaatgcctcgggtcacaagtacggtatg
agcactgtgggtgtcggatggatcatctggaggtctatggagtaccttcctaaggagttg
atctttgagcttcactatctcggtgctaccgattattcatttaatctcaatttcagtaga
ccggcacaccctatcctcgcccagatgttcactttcttgaacctcggtttcgaaggttac
aagcgtataatggacaagaacctcaccgtagctcgtctcatctcccgagccctcgagcac
tctggctacttcatttgtctctccaagatccaccaccccaaggctcttaccgaatcctcc
agcagcgccgaacaatccaacatcctccctgccgtcgccgacgccgctaataccgttttg
cacggcaagaagactactgttgacgatgccgagtattattgcgagggtttgcccgttgtg
tcgtttatgtttacggacgaaattaagaagaagtaccctggtgtgaagcaggcgtggatc
cagatgcagctgaggtctatcggctggatcgtccccaactaccctctcgctcccgactgc
gagaaaactgagatcctccgagtcgtcgtccgagagtccctttctggtgacttggcgagg
aagctcatccacgacattcttcaggtaaccgaagatctcctaaatgacgctggaccttca
tactccatgtctactgctaccaggcgtcacgagaatttggaccacggcaagctggataat
attgatgctgtccacatcaagcaacacacttccacctattctaagccctgttag

DBGET integrated database retrieval system