KEGG   Cupriavidus necator N-1: CNE_1c28710Help
Entry
CNE_1c28710       CDS       T01564                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase Ppc
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cnc  Cupriavidus necator N-1
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CNE_1c28710 (ppc)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CNE_1c28710 (ppc)
   00680 Methane metabolism
    CNE_1c28710 (ppc)
Enzymes [BR:cnc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CNE_1c28710 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1:2977429..2980467
Genome map
AA seq 1012 aa AA seqDB search
MTQHAARPHGRRTAPAAKDQSPALGAGQGDANGASTTESKRPATRSGTKRSPKPKLSIVS
SNGTAIAPTARRTADKDVPLREDIRFLGRLLGECLREQEGDAAFEVVETIRQTAVRFRRE
NDRAAGAELDRLLKRLSRDQTNQVVRAFSYFSHLANIAEDQHHNRRRRVHALAGSPPQAG
SLAHALEAIDAAGVTGKQLRKFLDEALIVPVLTAHPTEVQRKSILDAEREIARLLAERDL
PMTAREREHNTAQLRAKVTTLWQTRMLRDSRLTVADEIENALSYYRTCFLRGIPQLMSEL
EEDIAAVFPATRKRKGTPGAQPAPLAPFLQMGSWIGGDRDGNPNVTAETLEHAASQQGQM
IIDWYLDEVHALGAELSMSTLMVDASPELLALAERSPDHSEHRADEPYRRALIGIYARLA
ATSKALTGHAVPRRPVAPAEPYDSAEAFAADVQVVVDSLRANHGQALANGRIDALARAIG
VFGFHLASVDMRQVSDVHEAVIAELFAAAGIAPDYAALPEARKLELLLAELRQPRLLTLP
WHEYSEQTRKELAIFAAARELRARYGKRIARNYIISHTETLSDLVEVMLLQKESGMLQGT
LGSKTDPARMELMVIPLFETIEDLRNAAGIMQSLLDLPGFDSVIAHHGVEQEVMLGYSDS
NKDGGFLTSTWELYKAELALVQLFEQRQVKLRLFHGRGGTVGRGGGPTYQAILSQPPGTV
NGQIRLTEQGEIINSKFANAEIGRRNLETVVAATLEASLLPQQNAPRELDTFEAVMQQLS
DRAFTAYRDLVYETPGFKDYFFATTPITEIADLNLGSRPASRKLMDKKNRRIEDLRAIPW
GFSWGQCRLLLPGWYGFGSAVKSLLDTAPDDKARKLAVTTLRRMVKTWPFFSTLLSNMDM
VLAKTDLAVASRYAQLCDDAALRRTVFNRISKEWHLTCEMLTLVTGHQERLADNPLLARS
IKNRFAYLDPLNHLQVELLKRFRSGKDGDDIRVRRGIHLTINGVAAGLRNTG
NT seq 3039 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagcatgctgcgcgcccccacggccggcggaccgccccggctgcgaaagaccaa
agccctgccctcggcgccggccaaggtgacgcaaacggcgcatccaccaccgaatcgaaa
cgccccgccacccgcagcgggaccaaacgttcccccaagcccaagctttccatcgtgtcg
agcaacggaaccgccatcgcccccaccgcccgccgcaccgccgacaaggacgtgccgctg
cgcgaggacatccgcttcctgggccgcctgctgggcgaatgcctgcgcgaacaggaaggc
gacgcagccttcgaggtggtcgaaaccatccgccagaccgcggtgcgcttccgccgcgag
aacgaccgcgccgccggcgcggagctggaccgcctgctcaagcgcctgtcgcgcgaccag
accaaccaggtcgtgcgcgcgttcagctatttctcgcacctggccaatatcgccgaggac
cagcaccacaaccgccgccgccgcgtgcacgcgctggccggctcgccgccgcaggcgggc
agcctggcccacgcgctggaggcgatcgacgctgccggcgtgaccggcaagcagctgcgc
aagttcctggacgaggccctgatcgtgccggtgctgaccgcgcacccgaccgaagtccag
cgcaagagtattctcgacgccgagcgcgagatcgcccgcctgctggccgagcgcgacctg
ccgatgaccgcgcgcgagcgcgagcacaacaccgcgcagctgcgcgccaaggtcaccacg
ctgtggcagacccgcatgctgcgcgattcgcgcctgacggtggccgacgaaatcgaaaat
gcgctgtcgtactaccgcacctgcttcctgcgcggcattccgcagctgatgagcgaactg
gaagaagacatcgccgcggtgttcccggccacgcgcaagcgcaagggcacccccggcgca
cagccggcgccgctggcgccgttcctgcagatgggctcctggatcggcggcgaccgcgac
ggtaaccccaacgtcaccgccgagacgctggagcacgccgccagccagcaggggcagatg
atcatcgactggtacctggacgaagtccatgcgctgggcgcggagctgtcgatgtccacg
ctgatggtcgacgccagcccggaactgctggcgctggccgagcgctcgcccgaccactcc
gagcatcgcgccgacgagccctaccgccgtgcgctgatcggcatctacgcgcgcctggcc
gcaaccagcaaggcgctgaccggccacgccgtgccgcgccgcccggtggcgccggccgag
ccctatgacagtgccgaggcctttgccgccgacgtgcaggtggtggtcgactcgctgcgc
gccaaccatggccaggcgctggccaatggccgcatcgacgcgctggcgcgcgccatcggc
gtgttcggcttccacctggcatcggtcgacatgcgccaggtctcggacgtgcacgaggcg
gtcatcgccgagctgttcgccgccgccggcatcgcccccgactacgccgccctgcccgag
gcgcgcaagctggaactgctgctggccgagctgcgccagccgcgcctgctgacgctgccg
tggcatgagtactctgagcagacccgcaaggaactggcgatcttcgccgccgcgcgcgag
ctgcgcgcgcgctatggcaagcgcattgcgcgcaactacatcatctcgcacactgagacg
ctgtcggacctggtcgaagtgatgctgctgcagaaggaatccggcatgctgcagggcacg
ctgggcagcaagaccgacccggcgcgcatggagctgatggtgatcccgctgttcgagacc
atcgaggacttgcgcaacgccgccggcatcatgcagtcgctgctggacctgccgggcttc
gattcggtgatcgcgcaccatggcgtcgagcaggaagtgatgctcggctactcggactcg
aacaaggacggcggcttcctgacctccacctgggagctgtacaaggccgagctggcgctg
gtgcagctgttcgagcagcgccaggtcaagctgcgcctgttccacggccgcggcggcacc
gtcggccgcggcggcggcccgacctaccaggccatcctgtcgcagccgccgggcacggtg
aacggccagatccggctgaccgagcagggcgagatcatcaacagcaagttcgccaacgcc
gagatcggccggcgcaacctggagacggtggttgcggccacgcttgaagcctcgctgctg
ccgcagcagaatgcgcccagggagctggacaccttcgaggccgtcatgcagcagctgtcg
gaccgcgccttcaccgcctaccgcgacctggtctacgagaccccgggcttcaaggactac
ttcttcgccaccacgccgatcaccgagatcgccgacctgaacctgggttcgcgcccggcc
tcgcgcaagctgatggacaagaagaaccgccgcatcgaagacctgcgcgcaatcccgtgg
ggcttctcgtggggccagtgccgactgctgctgccgggctggtacggcttcggcagcgcg
gtcaagtcgctgctggacactgcgccggacgacaaggcgcgcaagctggccgtgaccacg
ctgcgccgcatggtcaagacctggccgttcttctcgacgctgctgtccaacatggacatg
gtgctggccaagaccgacctggccgtggcctcgcgctacgcccagctgtgcgacgacgcg
gccctgcgccgcaccgtgttcaaccgcatcagcaaggaatggcacctgacctgcgagatg
ctgacactggtcaccggccaccaggaacggctggcggacaacccgctgctggcgcgctcg
atcaagaaccgctttgcctacctcgacccgctgaaccacttgcaggtcgagctgctcaag
cgtttccgctcgggcaaggatggcgatgacatccgggtgcggcgcggcatccacctgacc
atcaacggggtcgcggcgggcctgcgcaatacgggctga

DBGET integrated database retrieval system