KEGG   Cupriavidus necator N-1: CNE_2c18520Help
Entry
CNE_2c18520       CDS       T01564                                 

Gene name
lig2
Definition
(GenBank) DNA ligase Lig
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cnc  Cupriavidus necator N-1
Pathway
cnc03030  DNA replication
cnc03410  Base excision repair
cnc03420  Nucleotide excision repair
cnc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CNE_2c18520 (lig2)
   03410 Base excision repair
    CNE_2c18520 (lig2)
   03420 Nucleotide excision repair
    CNE_2c18520 (lig2)
   03430 Mismatch repair
    CNE_2c18520 (lig2)
Enzymes [BR:cnc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNE_2c18520 (lig2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNE_2c18520 (lig2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNE_2c18520 (lig2)
DNA replication proteins [BR:cnc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNE_2c18520 (lig2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNE_2c18520 (lig2)
DNA repair and recombination proteins [BR:cnc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNE_2c18520 (lig2)
   NER (nucleotide excision repair)
    Other NER factors
     CNE_2c18520 (lig2)
   MMR (mismatch exicision repair)
    Other MMR factors
     CNE_2c18520 (lig2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEI80808
UniProt: F8GR63
LinkDB All DBs
Position
2:1996693..1998366
Genome map
AA seq 557 aa AA seqDB search
MKAFADLYAALDGTTSTKARLAALIDYLRVAPPEDAAWAVYFLAGGKPRQIVPVSLLREL
ARQAAELPDWLFEESYQAVGDLAETIALLLPEPMDADHAGLAEWVEQRLLPLRGLPPEAL
MPRLDALWRPLDAHGRLVLFKLITGAFRVGVSRLLVTRALGEVAGIDPKRVAERMVGYTD
LSARPDAAHFLALIAPEGDDHRELRGGGQPYPFFLAHPLQAPLEEFDSVLGTTENWLVEW
KWDGIRAQLVRRGGQAWLWSRGEELITERFPEILEAAGQLPDGTVLDGEIVVWQQGRVQP
FALLQQRIGRKTLSAKLLREAPAILMAYDLLEWHGADWRTRPEAERRARLEQVVADYVHP
SLELSPLVEAESWEHFARLRDASRELGVEGFMLKAASAAYGAGRTKDVGIWWKWKIDPYS
VDAVLVYAQRGHGRRASLYTDFTFAVWNAPPGTPGRALVPFAKAYSGLTDEEMRAVDAIV
RRTTVEKFGPVRSVEPTQVFELGFEGIARSGRHKSGIAVRFPRMLRWRTDKPIEEADTLA
TLEAMLPGAAAPREDAA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcgccgacctctacgccgcgctcgacggcaccacctcgaccaaggcccgc
ctcgccgcgctgatcgactacctgcgcgtggcgccgccggaagacgccgcctgggcggtc
tatttcctcgccggcggcaagccgcgccagatcgtgccggtctcgctgctgcgcgaactg
gcgcgccaagccgccgagctgcccgactggctgttcgaggaaagctaccaggccgtcggc
gatctcgccgagaccatcgccctgctgctgcccgagccaatggacgccgaccacgccggc
ctggccgaatgggtcgaacagcggctactgccgctgcgcggcctgccgcccgaagcgctg
atgccgcgtctcgatgcgctgtggcggccgctcgacgcgcacggccggctggtcctgttc
aagctgatcaccggcgccttccgcgtgggcgtatcgcggctgctagtgacgcgcgcgctc
ggtgaagtggccggtatcgaccccaagcgcgtggccgagcgcatggtcggctacaccgac
ctgtccgcgcgtcccgatgccgcgcacttcctggcactgatcgcaccggaaggcgacgac
caccgcgaactgcgcgggggcggccagccctacccattcttcctcgcgcatccgctgcag
gcgccgctcgaagagttcgatagcgtcttgggcaccacggaaaactggctggtcgaatgg
aaatgggacggcatccgcgcacaactggtccgtcgcggcggccaggcctggctgtggtcg
cgtggcgaggaactgatcaccgaacgctttccggaaatcctggaagcggccgggcaactg
ccggacggcaccgtgctcgacggcgagatcgtggtctggcaacagggccgcgtgcagccc
ttcgcgctgctgcagcagcgcatcggccgcaagacgctgagcgcgaagctgctgcgcgag
gcgcctgccatcctgatggcctatgacctgctcgaatggcacggcgctgactggcgcacc
cgaccagaggccgagcgtcgcgcgcgactggaacaagtggtggcggactacgtccaccct
tcgctcgaactcagcccgctggtggaggccgagagctgggaacacttcgcgcggctgcgc
gatgcctcacgcgaactcggcgtcgaaggtttcatgctgaaggccgccagcgcggcctac
ggcgcgggccgcaccaaggacgtaggcatctggtggaagtggaagatcgacccctactcg
gtcgatgcggtgctggtctacgcgcagcgcgggcacggccgccgcgccagcctctatacc
gactttaccttcgcggtctggaacgccccgcccggcacgcccggccgcgcgctggtgccg
ttcgccaaggcatattccggcctgaccgatgaagagatgcgcgcggtcgacgcgatcgtg
cgccggaccacggtagagaaattcggcccggtgcgcagcgtggagcccacgcaggtattc
gagctcggcttcgagggcatcgcccgcagcggccggcacaagagcggcattgcggtgcgc
tttccgcgcatgctgcgctggcgcaccgacaagccaatcgaagaagccgatacgctggcc
acgctggaagcgatgctgccgggcgccgccgcgccgcgggaggatgcggcatga

DBGET integrated database retrieval system