KEGG   Cupriavidus necator N-1: CNE_2c23180Help
Entry
CNE_2c23180       CDS       T01564                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cnc  Cupriavidus necator N-1
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cnc00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    CNE_2c23180
Enzymes [BR:cnc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNE_2c23180
DNA repair and recombination proteins [BR:cnc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     CNE_2c23180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
2:2503491..2506232
Genome map
AA seq 913 aa AA seqDB search
MAKTTRPTAPQDPGKRRALAKAAGKHTGKRASTARPAARGAPAAKAAPAALDKYRRMRDF
GATPEPAGGAARTRGKPRKRAGELSFVIQKHAARRLHYDFRLELGGTLKSWAVPKGPSLD
PADKRMAIHVEDHPLDYAGFEGVIPAGHYGAGTVIVWDRGTWLPVGDAEAGYRAGKLKFE
LRGEKLHGHWTLVRMHGSRQKEQDAWLLIKERDETAVPASEFDVVEALPDSVLGGTQRKP
AAKRAKTAQPPDEAAPDARSTAKSLKPPRGAPRAALPLALAPQLATLVEQPPSDAQAWHY
EIKFDGYRLLARIAGKDVRLFTRQGHDWTSKLRALARDVGTLGPPDGWLDGEIVVLDKHG
ATDFQALQNAFDTARVEAIQYFVFDLPYFAGHDLRKVPLVERRALLRRIFAHNTSPRLQF
SEDFEASPADMLEAACRMKLEGVIGKRADASYVSARTNTWIKLKCTLRQEFVVAGFTDPK
GSRAGIGSLLLGVHDSGGRLRYAGNVGTGFDTRTLAALRTQLDALRTDSAPFESVPAGVK
GHWVRPKLVAEVSFGSWTREGRVRHAVFHGLRTDKPARAVSVERPATPAAKGKPAPKAAK
HTGTQPKAGTAAKRATAAGGKVAISHAGRVIDTASGLTKGDLVRYYERAAPLMLPHLRGR
PIAMVRAPSGVGGEQFFQRHGDTLRVDGLNVLDSGLWPGHPALLEIASAEALVSAAQLNV
VEFHTWNASKRSLDRPNRIVFDLDPGEGVPWAQMQEAATLMKALLDELGLASFLKTSGGK
GLHVVVPITPRAGWDEVKAFAHDVVRHVAKTIPQRFVAKSGPRNRVGKIFIDYLRNGVGA
TTAAAFSARARPGLGVSMPVWWEELDTLQGAAQWTVANAGPRLDALAADDPWADYADTRQ
AITRAAARLARTG
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccacgcgaccgacagcgccacaggatccaggcaaacgccgcgccttagca
aaagccgccggcaagcacacgggcaagcgcgccagcacggcgcgcccggcggcacgcggc
gcgccagccgccaaggccgcccccgctgcgctcgataaataccgccgcatgcgcgacttc
ggcgccacgccggagcccgccggcggcgccgcgcgcacccgcggcaagccgcgcaagcgc
gccggcgagctgtccttcgtgatccagaagcacgcggcgcgtcggctgcactatgacttt
cgccttgagcttggcggcacgctgaaaagctgggccgtgcccaagggcccgagcctggac
cctgccgacaagcgcatggccatccatgtcgaggaccacccgctggactacgccggcttc
gagggcgtgatcccggccggccactacggtgccggcacggtcatcgtctgggaccgcggc
acctggttgccggtgggcgatgccgaggccggctaccgcgccggcaagctgaagttcgag
ctgcgcggtgaaaagctgcacggccactggaccctggtgcgcatgcacggcagccggcag
aaggagcaggacgcctggctgctgatcaaggagcgcgacgagaccgccgtgccggcatcg
gagttcgacgtggtcgaggccttgccggacagcgtgctgggcggcacgcagcgcaagcct
gcggcaaagcgcgcaaagaccgcccagccgcctgacgaagccgcaccagatgcgcgcagc
acggcgaagtccctgaagccgccgcgcggcgcgccgcgcgcggccttgccgctggcgctg
gcgccgcagctggccacgctggtggaacagcctccgtcggacgcgcaggcctggcattac
gagatcaagttcgacggctaccggctactggcccgcatcgccggcaaggatgtgcgcctg
ttcacgcgccagggccacgactggaccagcaagctgcgtgcgctggcgcgcgacgtcggc
accctgggcccgcccgacggctggctcgatggcgagatcgtggtgctcgacaagcatggc
gcgaccgacttccaggcgctgcagaacgccttcgataccgcgcgcgtcgaggccatccag
tacttcgtgttcgacctgccctactttgccggccatgacctgcgcaaggtgccgctggtg
gagcgccgcgccctgctgcgccggatcttcgcgcacaacacctcgccgcgcctgcagttc
agcgaggacttcgaggccagccctgccgacatgctcgaggcagcctgccgcatgaagctt
gaaggcgtgatcggcaagcgcgccgacgccagctatgtcagcgcgcgcaccaatacgtgg
atcaagctgaaatgcaccttgcgccaggagttcgtggtggcgggtttcaccgacccgaag
ggcagccgcgccggcatcggctcattgctgcttggcgtgcacgacagcggcgggcggctg
cgctacgcgggcaatgtcggcaccggcttcgacacgcgcaccctggctgcgctgcgcacg
cagctggacgcgttgcgcaccgattccgcgccctttgagagcgtgccggcaggcgtgaaa
gggcactgggtgcggccaaagctggtggccgaagtctcgttcggcagctggacccgcgaa
ggccgcgtgcgccatgccgtcttccacggcctgcgcaccgacaagcccgcgcgcgcggtg
tcggtggagcggccggcaacgccggcagccaagggcaagccggcgccaaaagcagcaaag
cacaccgggacacagccgaaggccggcaccgccgcaaagcgtgcaaccgccgccggcggc
aaagtcgcgatcagccatgccgggcgcgtcatcgacacagcatccggcctgaccaagggc
gacctggtgcgctactacgaacgcgccgcaccactgatgttgccgcacctgcgcgggcgt
ccgatcgcgatggtgcgcgcgccgtcgggcgtgggcggcgagcagttcttccagcgccat
ggcgacacgctgcgggtggacggcctcaacgtgcttgattcgggcctgtggcccgggcat
cccgcgctgctggaaatcgcgtcagccgaagcgctggtgtccgcggcacagctcaacgtg
gtggagttccacacctggaacgccagcaaacgcagcctcgaccgccccaaccggatcgtc
ttcgacctggacccgggcgaaggcgtgccctgggcacaaatgcaggaagccgccacgctg
atgaaggcgctgctcgatgaactcggcctcgccagcttcctgaagaccagcggcggcaag
gggctgcacgtggtggtgccgatcacgccgcgcgcgggctgggacgaggtgaaggcgttc
gcgcatgacgtggtgcgccatgtcgccaagaccattccgcagcgcttcgtggccaagagc
gggccacgcaaccgcgttggcaagattttcatcgattacctgcgcaatggcgtcggtgcc
accacagcggcggcattctcggcgcgggcacgcccggggctgggcgtgtcgatgccggtg
tggtgggaagaactcgataccctgcaaggcgcggcgcagtggaccgtcgccaatgcgggc
ccaaggctcgacgccctggccgccgacgacccatgggcggactacgccgacacccggcag
gcgatcacgcgcgccgctgcgcgactggctcgcaccggctag

DBGET integrated database retrieval system