KEGG   Cryptococcus neoformans var. neoformans JEC21: CNI04170Help
Entry
CNI04170          CDS       T00243                                 

Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cne  Cryptococcus neoformans var. neoformans JEC21
Pathway
cne03030  DNA replication
cne03410  Base excision repair
cne03420  Nucleotide excision repair
cne03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cne00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CNI04170
   03410 Base excision repair
    CNI04170
   03420 Nucleotide excision repair
    CNI04170
   03430 Mismatch repair
    CNI04170
Enzymes [BR:cne01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNI04170
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNI04170
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNI04170
DNA replication proteins [BR:cne03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNI04170
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNI04170
DNA repair and recombination proteins [BR:cne03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNI04170
   NER (nucleotide excision repair)
    Other NER factors
     CNI04170
   MMR (mismatch exicision repair)
    Other MMR factors
     CNI04170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 3259559
NCBI-ProteinID: XP_572602
UniProt: Q5KB11
LinkDB All DBs
Position
9:complement(join(1107575..1107742,1107795..1108142,1108195..1108425,1108481..1108663,1108727..1108938,1108997..1109082,1109141..1109216,1109267..1109429,1109484..1109585,1109640..1109780,1109839..1110010,1110061..1110129,1110178..1110493,1110549..1110686,1110734..1110740))
Genome map
AA seq 803 aa AA seqDB search
MSDIEYPVKSNIRKKRTVILSDDEDEGLGPSVIKEQVSSPKHSHLSDEETEPPRKVAKTS
SKVAPIFAPKEKKEKPSPKTSSALSKAPAKKIEVKSKGEKPLASIFTKATRKPEPKDDDE
MSDEVKQKGKDEEEEDEIYDEVEDKQEGEAAVKLASIFTKNQKSVPVADKGWKDGEAVPY
PALVSTFEKIEATTKRLEILEFLTQFLLVVAKRDTATDAKGSMLLKVVYLCINRLCPDYM
GIELGIGESLLIKAIAESTGRAMPKIKEDLKKEGDLGKVAMNSRNTQSTMFKPKPLTVPY
VFQCLTDIAKASGNASQAKKVGIIKKLLAACQGTEAKFIIRSLEGKLRIGLADKTVVVAL
AHAIVLKTIGDKKPPPEKLAIMLEQGAETVKAVYSELPSYDLVIPALLQGGVEGLRERCK
LTPGVPLKPMLAKPTKAITEVLDRFEGKEFTCEYKYDGERAQVHLLEDGTISVFSRNSEN
MSAKYPDLVDQIPRSMKPTAKTFVIDAEAVAYDLETKKILPFQDLSRRKRKDVKAEDITV
RVHIFAFDLLYLNGESLLAKELKERRQLLQEHFQPVESEFAFAKSSDGSTTEEIQALLEE
SVKDGCEGLMVKMLTSESSTYEPSRRSMNWLKLKKDYLSGVGDSLDLVVVGAYHGKGKRT
AVYGAFLLACYDPDSEHYQTICKIGTGFSEEILTQFYELLKPLELEVVRGDIEVGGAKPD
VWFEPRVVWEVLTADLSLSPIYAAAHGVIDSRGISLRFPRFIRIRDDKSADEATTAEQVS
EFYQRQISAGGKKGAGADVDDFW
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatagagtatccagttaagtctaatatcaggaaaaagaggacggttattctt
tcggatgacgaggacgaaggacttggtccatctgtgattaaggagcaagtctcgtctccc
aaacattctcatctatctgatgaagagacggagcctccccggaaagttgcaaaaacgtca
tccaaagtcgcgcctatctttgctcccaaagagaagaaagaaaaaccatctcccaagact
tcatcagctttatctaaagcacctgccaagaagatagaagtaaagagcaagggtgaaaaa
ccacttgcatcaatattcacaaaagccacacggaagcctgagcctaaggatgacgacgaa
atgtcggacgaggtgaaacaaaaggggaaagatgaggaagaggaggatgagatatatgat
gaagttgaggataagcaggagggagaggccgctgtcaaactggcctcaatctttaccaag
aatcaaaagtctgtccctgtggctgacaagggctggaaagacggcgaagctgtcccatat
cccgctcttgtatcaacgttcgaaaaaattgaggctacgactaagcgattagagatcctc
gaattcttaacccagtttttactcgttgttgccaagagagatacagccacagacgccaaa
gggtctatgctccttaaagtggtctatctttgtatcaacaggctatgccccgactatatg
ggtatcgaacttggtattggagaatcattattgatcaaggccattgcggagagcacaggg
cgggctatgcccaagatcaaagaagatttaaagaaggaaggagacctcggaaaggttgcc
atgaactctagaaacactcaatcaaccatgttcaaacccaaacctttgacagtaccatat
gttttccaatgtctcactgatatcgcaaaggctagcgggaacgcgtcacaagcaaagaaa
gtaggcattattaagaaactccttgctgcttgccaaggcaccgaggccaaatttatcatc
cgatccctcgaaggaaaattacgaatcggtcttgccgacaagacagtcgtggttgccttg
gctcacgctatcgtcctgaagacaattggtgacaaaaaaccgccacctgaaaaacttgct
atcatgctggaacagggcgctgagactgttaaagctgtctatagtgagcttccatcgtac
gacctggtaatccctgctcttctccaaggaggcgtagaaggtttgagagaacgctgtaaa
cttactccaggcgttcctctcaaacctatgcttgctaagccgacgaaagccatcacagag
gtccttgaccgtttcgaaggcaaggaattcacttgcgagtacaagtacgatggagaacgt
gcccaggtccacctgttggaagatggtaccatttctgtgtttagtagaaattcggaaaac
atgagtgccaagtatcccgatctggtggatcaaataccgaggtctatgaaacctactgcc
aagacgtttgtcatcgatgccgaagccgttgcttatgatttggaaaccaagaagattctt
cctttccaagacctgagtaggcgaaagcgaaaggacgtcaaggccgaggacatcacagtg
cgggtgcatatctttgcgttcgatttgctctatctcaatggagagagtcttctcgctaaa
gagcttaaagaaagacgacagctcctacaagagcatttccaacctgtggaatcggagttt
gcgtttgccaagtcatcagatggaagcacgacagaagagatccaggcattgctcgaagaa
agtgtgaaggatgggtgtgagggtttgatggtgaaaatgctcactagcgagtcatcaaca
tatgagcccagtagaagaagtatgaattggctcaagctcaagaaagactacctttcaggt
gttggagactctctcgatcttgttgtcgttggagcatatcatggcaaaggcaaacgtaca
gcagtctatggcgctttcctcctcgcgtgctatgatcccgattcggaacattatcagact
atctgcaagattggtaccggtttctccgaggaaatcctcacacaattctacgagttactt
aaacctttagaactggaagtcgtgagaggagatatagaggttggaggagccaaaccggat
gtatggtttgagcccagagtggtctgggaggtcttaacagccgatttgagtttaagtccg
atttacgcggcggcacatggtgtaatcgattctcgaggaatctcgctccgtttccctcgg
tttatcaggattagagacgacaagtctgctgacgaagccacaacggctgagcaggtcagc
gagttctatcaacgtcagatttcggcaggtggcaagaaaggggcgggggcggacgtggat
gacttctggtaa

DBGET integrated database retrieval system