KEGG   Colwellia sp. PAMC 21821: A3Q33_14855Help
Entry
A3Q33_14855       CDS       T04816                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
colw  Colwellia sp. PAMC 21821
Brite
Enzymes [BR:colw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     A3Q33_14855
Peptidases [BR:colw01002]
 Metallo Peptidases
  Family M2
   A3Q33_14855
Exosome [BR:colw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A3Q33_14855
CD molecules [BR:colw04090]
 Proteins
  A3Q33_14855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3517505..3519349)
Genome map
AA seq 614 aa AA seqDB search
MKPTFKLTTAAIIVAASLSACNGDNTVTNDAKPTIPASKVLTVQDAEKFLVATEKELVQL
NTEGSRAAWINSNFITEDTSALAAAADQKSTEAGVRFAMQAAKFDSVNVNADQRRKLNIL
KQSLVMPAPQDSAKSAELAKIGAQLNSMYGKGNYTAKSGETLSLGQMTATMATSRDYDEL
LEMWQGWRTISPDMKPLYTRQAALGNEGAQGLGYADLGAMWRSNYDMSADEFAKELDRLW
GQVKPLYDDLHCYVRTELGKTYGEDKVPQDQPIPAHLLGNMWAQSWGNIYDLVAPEDADP
GYDVTQQLAANNYDEVSMVRGAEGFFTSLGFEALPETFWQRSLFTKPADRDVVCHASAWD
LDAKDDIRIKMCIQKTGEDFSVIHHELGHNFYQRAYQNQPVYYQNSANDGFHEAIGDTIA
LSVTPKYLKEIGLIDTIPDESKDIGLLLKMALDKVAFMPFGLMVDQWRWKVYSGEVTPEN
YNTAWWELREKYQGVSAPIERELNAFDPGAKYHVPGGVPYSRYFLAHIQQFEFHRALCEI
SGNTDAIHRCSIYNNKAAGTALNTVLEMGSSQPWQQAYKVLTGNEQMDATAILDYFAPLH
TWLKDKNQGKQCGF
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccaacatttaaattaaccacggcagctatcatagtagcagcaagcttaagtgcc
tgtaatggcgacaacacagtcactaatgatgctaagccaacaatcccggcaagcaaagta
ttaacggtacaagatgctgagaaatttttagtcgctaccgaaaaagagctagtgcaactt
aacactgaaggcagccgtgcggcgtggataaattcaaactttattactgaagacacctct
gcactcgccgctgcagccgatcaaaagtcaactgaagcgggtgtaagatttgctatgcaa
gccgctaaatttgactctgttaatgtaaacgcagatcaacgtcgaaaactcaatatttta
aaacaaagtttagtgatgcccgcacctcaagattcggctaaatccgcagaattagctaaa
attggtgctcaattaaatagtatgtatggtaaaggaaattacactgcaaaatcaggtgag
acattaagcttaggccagatgaccgcaacaatggcaacatcacgagactacgatgaatta
ttagaaatgtggcaaggctggcgaacaatcagtcctgacatgaaaccattatatactcgc
caagccgcattaggtaatgaaggcgcacaaggcttaggctatgcagatttaggtgcaatg
tggcgttcaaattacgatatgtctgcagatgaattcgctaaagagcttgaccgtttatgg
ggacaggtaaaacccttatacgatgatttacattgttacgtgcgcactgaattaggcaaa
acttacggcgaagacaaagtgccgcaagatcaaccaatacccgctcatttacttggtaat
atgtgggcacagtcttggggtaatatttatgacctagtcgcaccagaagatgccgatcct
ggatatgatgttacccaacaacttgccgctaataattacgatgaagttagcatggtaaga
ggagccgaaggcttttttacctcacttggctttgaagcattaccagaaacattttggcag
cgttcgttatttactaagcccgccgaccgagatgtggtatgtcatgcctcagcatgggac
ttagatgccaaagatgatattcgtattaaaatgtgtatccaaaaaaccggtgaagacttc
tcggttattcatcacgaactaggccataatttttatcaacgtgcataccaaaaccagccg
gtatattaccaaaacagcgctaatgacggttttcatgaagctattggcgatacaattgct
ctgtcagttacaccaaaatacttaaaagaaattggcttaattgacactattcctgatgag
tcgaaagacattggtttactattgaaaatggctttagataaagtcgcttttatgccattt
ggtttaatggttgaccaatggcgttggaaggtatattcaggtgaagttacgccagaaaac
tataatacggcttggtgggaattacgtgaaaaataccaaggtgtaagcgcccctatcgaa
cgtgaacttaatgcttttgacccaggcgcgaaatatcatgtgcccggaggcgtaccttat
tcacgctacttcttagcacatattcagcaatttgaatttcatcgtgctttatgtgaaatt
tcaggtaacaccgatgctattcatcgttgttcaatttataacaacaaagcggctggaacc
gcgttaaataccgtactcgaaatgggttcaagccagccatggcaacaagcgtataaggtg
ttaacaggtaacgagcaaatggatgcaaccgccattcttgattattttgccccattacac
acctggttgaaagataaaaaccaaggcaagcaatgtggtttttaa

DBGET integrated database retrieval system