KEGG   Corynebacterium pseudotuberculosis 267: Cp267_0427Help
Entry
Cp267_0427        CDS       T01934                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cor  Corynebacterium pseudotuberculosis 267
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cor00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Cp267_0427 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Cp267_0427 (alr)
Enzymes [BR:cor01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Cp267_0427 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cor01011]
 Precursor biosynthesis
  Racemase
   Cp267_0427 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
425143..426255
Genome map
AA seq 370 aa AA seqDB search
MNLLEARIDLAAIAHNTRLIKDKAAAQGAQLMCVVKADGYNHGAVEVATVMEENGADQFG
VATIGEGLALREGGIESSILSWIWSPEQDLGAAITAEIDLAAISLEHVKALVRASESYGK
KPVRVTVKVDTGLHRSGVDKQDWRESFCMLRDAENIQVTGVFSHFSSADESDSTETEQQE
RAFLNAIELGRSLGLELPVNHIANSPATLNRPDLYFDMVRPGLALYGHEPIPGESHGLRE
AMSWVGRVTVVKPIARGEGTSYGLTWRAEQDGYLCVVPVGYADGLPRSAQGHLEITIGGR
RYPQVGRVCMDQIVVALGENPYGVAQGDEAVILGPTGMTATELATAMGTINYELVCRPCG
RTVRVFEHSD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacttgctcgaggcccgtatcgatttggccgccatcgcacacaacacccgtctgatt
aaagataaagctgcggcacaaggtgcgcagctgatgtgcgtggtaaaagccgatgggtat
aaccatggcgccgtggaagtggccacagtgatggaagaaaatggcgcggatcagtttggt
gtagcgactatcggggagggccttgcgctaagggagggtgggatagaatcgtcgattctt
tcctggatttggtcgccggagcaagacctcggggcggcgattactgcagaaattgatctg
gctgcgatctcgcttgagcatgttaaggcgttggtgcgggcgtcggaaagctatggcaaa
aaacctgtacgtgtcaccgtaaaagtagacactggcctgcatcgttctggtgtggataag
caggattggagagagtctttctgcatgctgcgtgatgccgagaatattcaggtcacaggg
gtgttcagccacttttctagtgcagatgaatcggattctacagagacagaacagcaggag
agggcttttctcaacgcgattgaactcgggcgctcgctgggcttggagcttcctgtcaat
cacattgctaattcgcctgcaacgctgaaccggccagatttatattttgatatggttcgt
cctggcctggccctttacggacacgaaccgattcctggagaatctcatggtctacgtgag
gcgatgtcttgggttgggcgagtaacggtggtaaaaccaatcgccaggggagaagggact
agttatggtctcacgtggcgtgcagagcaggacggatacctctgtgttgttcctgttgga
tacgccgatgggttgccgcgctctgcgcaaggacatttagaaatcacgattggtggacga
aggtatccgcaagtgggtcgcgtgtgtatggatcagatcgtggtggctttaggcgagaac
ccttatggtgtggctcaaggcgatgaggcagtcattctcggtccgacgggcatgaccgcc
acggagctcgccacagcaatggggacaatcaactatgaactcgtgtgtcgtccttgcggg
cgcaccgtgcgagtatttgagcacagcgattaa

DBGET integrated database retrieval system