KEGG   Clostridium pasteurianum BC1: Clopa_3199Help
Entry
Clopa_3199        CDS       T02645                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cpas  Clostridium pasteurianum BC1
Brite
Enzymes [BR:cpas01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Clopa_3199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
3191003..3191662
Genome map
AA seq 219 aa AA seqDB search
MYNIKPKTFDFKSVNGISAKQLDEHYKLYVGYVNTLNKIWNIPYIPENYTDSNSTYSNMR
SLKLGETYSLDGVKLHQLYFQNMTGGNNTPSGPLLNAIIDQFSSYDRFISYLTNVGLSMR
GWAILAIDSIDNKFHIIGSDLHDTGAVWLSYPLLVMDVYEHAYFMDFGTDKRKYISTFIN
NINWGVLNNRFANYVSSLQINNMNANMKRYSPYPFEFHY
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
ttgtataacataaaacctaaaactttcgattttaaatcagttaatggaatctcagctaaa
caattagatgaacattataaattatatgtaggatacgtaaatacattaaataaaatttgg
aatataccctatatacctgaaaattatactgatagcaattcaacttattcaaatatgcgt
agtttaaagcttggagaaacctattctttagatggtgtaaaacttcatcaactttatttt
cagaacatgacaggaggcaataataccccttctggcccattattaaatgctataatagat
cagttttcttcctatgacagatttatatcttatctcacaaatgtagggttgtctatgagg
ggatgggctattcttgctattgattctatagataataaatttcacataataggcagtgat
ttacatgatactggtgctgtatggctttcttatccattattagttatggatgtttatgag
catgcatattttatggattttggaacagataagagaaagtatatatctacttttattaac
aatataaattggggagttttaaataacagatttgcaaattatgtttcctccctgcaaatt
aataacatgaatgcgaatatgaaacgatatagtccttacccttttgaatttcattattaa

DBGET integrated database retrieval system