KEGG   Clostridium perfringens 13: CPE0725Help
Entry
CPE0725           CDS       T00074                                 

Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cpe  Clostridium perfringens 13
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpe00001]
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPE0725
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPE0725
Enzymes [BR:cpe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CPE0725
Bacterial toxins [BR:cpe02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CPE0725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Structure
PDB: 

Jmol
Position
900997..903081
Genome map
AA seq 694 aa AA seqDB search
MNYKGITLILTAAMVISGGNYVLVKGSTLDSGKNNSGYEIKVNNSESLSSLGEYKDINLE
SSNASNITYDLEKYKNLDEGTIVVRFNSKDSKIQSLLGISNSKTKNGYFNFYVTNSRVGF
ELRNQKNEGNTQSGTENLVHMYKDVALNDGDNTVALKIEKNKGYKLFLNGKIIKEVKDTN
TKFLNNIENLDSAFIGKTNRYGQSNEYNFKGNIGFMNIYNEPLGDDYLLSKTGETKAKEE
VLVEGAVKTEPVDLFHPGFLNSSNYRIPALFKTKEGTLIASIDARRHGGADAPNNDIDTA
VRRSEDGGKTWDEGQIIMDYPDKSSVIDTTLIQDDETGRIFLLVTHFPSKYGFWNAGLGS
GFKNIDGKEYLCLYDSSGKEFTVRENVVYDKDGNKTEYTTNALGDLFKNGTKIDNINSST
APLKAKGTSYINLVYSDDDGKTWSEPQNINFQVKKDWMKFLGIAPGRGIQIKNGEHKGRI
VVPVYYTNEKGKQSSAVIYSDDSGKNWTIGESPNDNRKLENGKIINSKTLSDDAPQLTEC
QVVEMPNGQLKLFMRNLSGYLNIATSFDGGATWDETVEKDTNVLEPYCQLSVINYSQKID
GKDAVIFSNPNARSRSNGTVRIGLINQVGTYENGEPKYEFDWKYNKLVKPGYYAYSCLTE
LSNGNIGLLYEGTPSEEMSYIEMNLKYLESGANK
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaagggataactttaattttaacagctgctatggttataagtggtggtaat
tatgtattggttaaaggaagtactttagactcagggaaaaataatagtgggtatgagatt
aaagtaaataatagtgaaagtttaagttcactaggagaatataaggatataaatttagaa
agttcaaatgcttctaatattacttatgatttagaaaaatataaaaatttagatgaaggt
actattgttgtaagatttaattctaaagattctaaaatacaaagcttattaggaataagt
aatagcaaaactaaaaatggatattttaatttttatgttactaattcaagagttggtttt
gagcttagaaatcaaaaaaatgagggaaatacacaaagtggaactgaaaatctagtacat
atgtataaagacgttgctttaaatgatggtgataatactgttgccttaaagattgaaaaa
aacaaaggttataagcttttccttaatggaaaaatcataaaagaagttaaagatacaaat
acaaagtttttaaataatatagaaaatttagatagtgcttttattggaaaaactaataga
tatggacaatctaatgaatataattttaagggcaatataggttttatgaatatatataat
gaacctttaggcgatgattatttacttagtaagactggagagacaaaagctaaagaagaa
gttcttgtagagggagctgtaaagacagagccagttgatttatttcatccaggattttta
aattctagtaattacagaataccagccttatttaaaacaaaagaaggaactttaatagct
tcaatagatgcaagaagacatggtggggccgatgctcctaacaatgatatagatacagca
gttagaagaagtgaagatggagggaaaacttgggatgaaggacaaataataatggactat
cctgataaatcctctgttatagatacaactttaattcaagatgatgaaacaggaagaata
ttcttgttggtaactcatttcccttcaaaatatggtttttggaatgctggattaggaagt
ggatttaaaaatattgatggaaaagaatatttatgtctttacgattcatcaggtaaagaa
tttactgtaagagaaaatgtagtatatgacaaagatggcaataaaacagaatatacaaca
aatgctttaggagatttatttaaaaatggaactaagatagataatataaattctagtaca
gcacctttaaaagcaaaagggacaagctatataaatcttgtatatagtgatgatgatgga
aagacttggagtgagccacaaaatattaatttccaagttaaaaaggattggatgaagttt
ttaggaatagctccaggtagaggaatacaaataaaaaatggagaacataaaggaagaata
gtagttcctgtttactatacaaatgaaaaaggtaaacaatctagtgctgtaatatatagt
gatgatagtggtaagaattggacaataggagaatctccaaatgataatagaaaattagaa
aatggaaaaataataaattctaaaaccttatcagatgatgcacctcaattaactgaatgt
caagtagtagaaatgccaaatggtcaactaaaattatttatgagaaatttaagtggatat
ttaaatattgctacaagttttgatgggggagctacttgggacgagacagtagagaaagat
actaatgttttagagccatattgccaattaagtgttataaattatagtcaaaagatagat
ggaaaggatgctgttatcttctcaaatccaaacgcaagaagtagatcaaatggtactgtg
agaattggattgattaatcaagttggaacatatgaaaatggtgaacctaaatatgaattt
gattggaaatataataaattagttaaaccagggtattatgcttattcttgtttaacagaa
ttaagcaatggaaatattggattattatatgagggtacaccaagtgaagaaatgtcttat
attgaaatgaatttaaaatatttagagagtggagctaataaataa

DBGET integrated database retrieval system