KEGG   Clostridium perfringens ATCC 13124: CPF_0861Help
Entry
CPF_0861          CDS       T00378                                 

Gene name
alr
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
cpf00473  D-Alanine metabolism
cpf01100  Metabolic pathways
cpf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CPF_0861 (alr)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CPF_0861 (alr)
Enzymes [BR:cpf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CPF_0861 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:cpf01011]
 Precursor biosynthesis
  Racemase
   CPF_0861 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF1884
Motif
Other DBs
NCBI-ProteinID: ABG82585
UniProt: Q0TSS9
LinkDB All DBs
Position
complement(1025324..1026484)
Genome map
AA seq 386 aa AA seqDB search
MDICVRPVWAEIDLDIIANNMKEIRNLVGEKEIIAVVKANAYGHGALDIASTLLENGASR
LAVAIITEADELRDAGITAPIMILGYTPINFAENLINNEIEQTVYDVEYAKELSDFALKL
GKKAKVHIAIDTGMGRIGFLPNEEGLNKVLEICSLPGVEVIGLFTHFSTSDEKDKTYTYE
QFSKLTAFNKALEDNGIHIPLKHASNSGAIMDLPETYLDGVRCGIISYGYYPSEEVKKEN
LKLKPALTLKTNVAFVKELDEDMYVSYGRTYKTEKKSKIATLPIGYADGYSRLLSGKAKV
IIKGQFANVIGRVCMDQCMIDVTHIEDVKIGDEVILLGEENGLKFDANDMAEIMGTINYE
ILCMISHRVPRIYKKNNEIVKVINYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggatatatgtgttagacctgtatgggctgaaatagatttagatataatagcaaataat
atgaaagaaataagaaacctagttggtgaaaaggaaataatagccgttgttaaggctaat
gcttatggtcatggagctttagacatagcttccactcttttagaaaatggtgcttctaga
ttggcagtagctataatcacagaggctgatgaacttagggatgctggaataactgcacct
attatgattttaggttatactcctataaattttgctgaaaatttaatcaataatgaaatt
gaacaaacagtttatgatgtggaatatgctaaggaattatctgactttgccttaaagctt
ggcaaaaaagctaaagtacacattgcaatagatacaggaatgggtagaataggcttcctt
ccaaatgaagagggattaaataaagttttagaaatctgctctttacctggagttgaggta
ataggcctatttactcacttctcaacatcagatgaaaaagataaaacttatacttatgaa
caattttcaaaattaactgcttttaataaagctttagaagacaatggaatacacattcct
ttaaaacatgcttctaatagtggggctattatggatttaccagaaacttatttagacgga
gttagatgtggaattatttcttatggatactatccatctgaagaagtaaaaaaagaaaac
ttaaaacttaaaccagcacttacattaaaaactaatgtagcctttgttaaagagttagat
gaagatatgtatgtaagctacggaagaacttataaaactgaaaagaaaagtaaaattgcc
actcttccaataggatatgctgatggatactcaagacttcttagtgggaaagccaaagtt
ataataaagggtcaatttgctaatgttataggaagagtttgtatggatcaatgtatgatt
gatgtaactcatatagaagatgttaaaattggcgatgaggtaattcttttaggggaagaa
aatggattaaaatttgatgctaacgatatggctgaaattatgggaacaataaactacgaa
atactttgtatgatcagccacagagttcctagaatatataaaaagaataatgaaatagtt
aaggtaataaactatatttaa

DBGET integrated database retrieval system