KEGG   Clostridium perfringens ATCC 13124: CPF_0985Help
Entry
CPF_0985          CDS       T00378                                 

Gene name
nanH
Definition
(GenBank) sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cpf  Clostridium perfringens ATCC 13124
Pathway
Other glycan degradation
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPF_0985 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPF_0985 (nanH)
Enzymes [BR:cpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CPF_0985 (nanH)
Bacterial toxins [BR:cpf02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CPF_0985 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1135175..1136323)
Genome map
AA seq 382 aa AA seqDB search
MYNKNNTFEKNLDISHKPEPLILFNKDNNIWNSKYFRIPNIQLLNDGTILTFSDIRYNGP
DDHAYIDIASARSTDFGKTWSYDIAMKNNRIDSTYSRVMDSTTVITNTGRIILIAGSWNT
NGNWAMTTSTRRSDWSVQMIYSDDNGLTWSNKIDLTKDSSKVKNQPSNTIGWLGGVGSGI
VMDDGTIVMPAQISLRENNENNYYSLIIYSKDNGETWTMGNKVPNSNTSENMVIELDGAL
IMSTRYDYSGYRAAYISHDLGTTWEIYEPLNGKVLTGKGSGCQGSFIKATTSNGHRIGLI
SAPKNTKGEYIRDNIAVYMIDFDDLSKGVQEICIPYPEDGNKLGGGYSCLSFKNGHLGIV
YEANGNIEYQDLTPYYSLINKQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtataacaaaaacaacacctttgaaaagaatctagatataagccataaaccagaacca
ctaatactatttaacaaggataataacatatggaattcaaagtattttagaattcccaat
atacaattattaaatgatggtacaattttaaccttttcagatattcgttataatggtcct
gatgaccatgcttatatagacatagcttctgcacgtagtactgattttggaaagacatgg
agctatgatatagcaatgaaaaacaatcgtattgactctacttattctcgtgtaatggac
tccacaacagttattacaaatacaggtagaataatattaattgcaggctcatggaataca
aatggaaactgggcaatgactacctccacaagaagaagtgattggtctgtccaaatgatt
tattctgatgataatggattaacttggtctaacaaaatagatttaactaaggactcatca
aaagtaaaaaatcaaccaagtaatacaattggatggttaggtggagttggctcaggtatt
gtaatggatgatggaacaatagttatgccagcacaaatttccttaagagaaaataatgaa
aataactattattcattaattatctattcaaaggataatggtgaaacatggacaatggga
aacaaggttcctaattcaaacacttctgaaaatatggtcatagaattagatggcgcttta
attatgagtacaagatatgattactctggttatagggcagcatacatctctcatgattta
ggaactacttgggaaatatatgaacctttaaacggtaaagttttaactggtaaaggctct
ggatgtcaaggttcatttattaaagctactacttcaaacggacatagaataggattaatt
tcagcacctaaaaatactaaaggtgaatatataagagacaacattgctgtttatatgatt
gactttgatgatttatctaaaggagttcaagaaatatgtattccttatcctgaagatggt
aacaaattaggcggtggatattcttgtctatcctttaaaaatggccatttaggcattgtt
tatgaagccaacggaaatatagaatatcaagacttaacaccttattactcactaattaat
aaacaataa

DBGET integrated database retrieval system