KEGG   Cnuibacter physcomitrellae: B5808_15145Help
Entry
B5808_15145       CDS       T04797                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cphy  Cnuibacter physcomitrellae
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cphy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B5808_15145
  Energy metabolism
   00680 Methane metabolism
    B5808_15145
Enzymes [BR:cphy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B5808_15145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3247451..3250129)
Genome map
AA seq 892 aa AA seqDB search
MPDVLRADVKLLGALLGTVLRESGGDDLLDDVETLRALTIGAFTHPESTEAIERAEAFVD
SLDATRAEELARAFTSYFHLVNLAEENHRVRVLRARAAAADPEHPSTETLPGALAALAAE
VGDEEAARRLAALEFRPVFTAHPTEARRRAVANAIRRIGALLAERDDPHTRGAVLAENER
ALLAEVDILWRTAPLRSEKPSPLDEVRTAMAVFDETLFGAVPDVYRSLDDAIAGEDAGVA
RPVAPAFVRLGSWIGADRDGNPNVTARITRTAAEIASEHVLLGLERATTRIARTLTLDAS
TTPPSPALSALREQQRQLAQDLAADIAERSPNEPHRQVMLFAAERIVATRRRDADLAYAS
AEELRSDLLVVQESLVTAGDRRSAYGELQRLLWQVETFGFHLAELEVRQHSKVHRTALAE
LRARDADPSAPIDDMTNEVLDVFRTIQHIQRRFGVIAARRYIVSFTQSSEDLANVYRLAQ
YAAGPGGEVPTLDVIPLFETFDDLQASTRILDEMLELPEVQARLAATGRRVEVMLGYSDS
SKDVGPVAATLALYDAQARIAAWAERNDIVLTLFHGRGGALGRGGGPANQAVLAQPPGSV
DGRFKLTEQGEVIFARYGNPVIAQRHIDQVASATLLASSPSNVARTSSAAEEFAPMAATM
DEASRARFFELVKADGFAAWFAQVTPMEEIGWLALGSRPARRGLSVSSLEDLRAIPWVFA
WTQARINLTGWFGLGTALAAVGDEALVRSAYERWPLFRAMIDNVEMSLAKTDDRIARRYL
ALGDRDDLAGLVLDEMALTRHWVLTATGSSSVLESRPVLRTAVQLRSPYVDALSLLQLRA
LRSLRAPEDAAAQVATQSPAAPAAPATPAAPDVRRLLLLSVSGVAAGLQNTG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgtgctccgtgccgacgtgaagctcctcggcgcgctcctcggaaccgtgctc
cgcgagagcggcggcgacgatctgctcgacgacgtcgagacgctgcgcgcgctcacgatc
ggcgccttcacgcatccggagtcgaccgaggcgatcgagcgggcggaggcgttcgtcgac
tccctcgacgccacccgcgccgaggagctcgcgcgcgccttcaccagctacttccacctc
gtgaacctcgccgaggagaaccaccgcgtccgcgtgctgcgtgcccgggcggcggcggcc
gaccccgaacatccgtcgaccgagacgctgcccggcgcgctcgccgcgctcgcggccgaa
gtcggcgacgaggaggccgcacgccgactcgcggcgctcgagttccgccccgtgttcacc
gcgcaccccaccgaggcgcggcggcgcgcggtcgcgaacgcgatccgccgcatcggtgcg
ctcctggccgagcgcgacgacccgcacacgcgcggtgccgtgctcgccgagaacgagcgg
gccctgctggccgaggtcgacatcctctggcgcaccgcgccgctgcgcagcgagaagccg
tcgccgctcgacgaggtgcgcacggcgatggcggtcttcgacgagacgctgttcggcgcg
gtcccggatgtgtaccgctccctcgacgacgccatcgccggtgaggatgcgggcgtcgcc
cgccccgtcgcccccgccttcgtgaggctcggcagctggatcggcgccgaccgcgacggc
aacccgaacgtcacggcccgcatcacccggaccgccgcggagatcgcgtcggagcacgtc
ctgctcggcctcgagcgcgccaccacccgcatcgcgcgcacgctgacgctcgatgcgtcc
accacgcctccgagccccgcgctcagcgcgctgcgcgagcagcagcgccagctcgctcag
gatctcgcggccgacatcgcggagcgctcgcccaacgagccgcaccgtcaggtgatgctg
ttcgccgccgagcggatcgtcgccacccggcgacgcgacgccgacctcgcgtacgcgagc
gcggaggagctgcgctccgacctgctcgtcgtgcaggagtcgctcgtcaccgcgggcgac
cgccgctcggcgtacggcgagctgcagcgcctgctgtggcaggtggagaccttcggcttc
cacctcgccgagctcgaggtgcggcagcactcaaaggtgcaccgcaccgcgctggcggag
ctgcgggcgcgcgacgccgatccgtccgccccgatcgacgacatgacgaacgaggtgctc
gacgtcttccggacgatccagcacatccagcgccgtttcggcgtgatcgccgcgcgccgg
tacatcgtgtcgttcacgcagtcgtccgaggacctcgccaacgtctaccgcctggcgcag
tacgccgccggtccgggcggcgaggtgccgacgctcgacgtcatcccgctgttcgagacg
ttcgacgacctgcaggcgtcgacgcgcatcctcgacgagatgctcgagctcccggaggtg
caggcgcgcctggccgccaccggccgccgcgtcgaggtgatgctcgggtactccgactcg
tcgaaggacgtcggccccgtcgccgccacgctcgcgctctacgacgcgcaggcgcggatc
gccgcgtgggccgagcgcaacgacatcgtgctgacgctcttccacggtcgcggcggcgcc
ctcggacgtggcggcgggccggccaaccaggccgtgctcgcccagcccccgggatccgtc
gacggccgcttcaagctcaccgagcagggcgaggtgatcttcgcccggtacggcaacccg
gtcatcgcgcagcggcacatcgaccaggtcgcctcggcgacgctgctcgcctcgtcgccg
tcgaacgtcgcccgcacgtcgtcggccgcggaggagttcgcgccgatggccgcgacgatg
gacgaggcgtcgcgcgcccggttcttcgagctcgtgaaggccgacgggttcgcggcctgg
ttcgcgcaggtcaccccgatggaggagatcggctggctggcgctcggatcgcgccccgcg
cggcgcggtctctcggtgtcgtcgctcgaggacctccgcgccatcccgtgggtgttcgcc
tggacgcaggcgcgcatcaacctcacgggctggttcgggctgggcaccgcgctcgcggcg
gtcggcgacgaggcgctggtccgctcggcctacgagcgctggccgctcttccgcgcgatg
atcgacaacgtcgagatgtcgctcgcgaagaccgacgaccggatcgcgcgccggtacctc
gccctcggcgaccgcgacgacctcgccggcctcgtcctcgacgagatggcgctcacgcgt
cactgggtgctcaccgccacgggctcctcgtcggtgctcgagtcgcggcccgtgctgcgc
accgccgtgcagctgcgctccccgtacgtcgacgcgctctcgctcctgcagctgcgtgcc
ctccgctccctccgggccccggaggacgccgccgcgcaggtggcgacgcagtcgcccgcc
gcccccgcggcccctgcgacccctgctgcaccggacgtgcgccgcctcctcctcctctcg
gtctcgggcgtcgccgccggcctccagaacacgggctga

DBGET integrated database retrieval system