KEGG   Chitinophaga pinensis: Cpin_1471Help
Entry
Cpin_1471         CDS       T00959                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpi  Chitinophaga pinensis
Pathway
cpi00620  Pyruvate metabolism
cpi00680  Methane metabolism
cpi01100  Metabolic pathways
cpi01120  Microbial metabolism in diverse environments
cpi01200  Carbon metabolism
Module
cpi_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cpin_1471
  Energy metabolism
   00680 Methane metabolism
    Cpin_1471
Enzymes [BR:cpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cpin_1471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACU58968
JGI: Cpin_1471
UniProt: C7PRS5
LinkDB All DBs
Position
1805292..1807871
Genome map
AA seq 859 aa AA seqDB search
MEAPVNNTLQLFKNLVGTKFQLYNSLFTALPFHKVERTGVFLSLFLIHCEEGYAKEKSPQ
EILNSYFQQYTSCSNEQQKLDLMFRFVQYAERQVVLFDALEDAAFRQIHDVHGAGTLSHL
LSEITSEQAGEQLAKKLQDYSVRLVLTAHPTQFYPGGVLTIINDLSRALINDNTAQVNAY
LQQLGKTPFFKKEKPTPYDEAISLIWFLENTFYPAAGRIISKLKSQFPAAVNSNNPVIRM
GFWPGGDRDGNPFVTADITLRTAEALRGGIIKCYYLDVRRLKRRLTFKGIEQELNMLEEK
LYNNLFIPGHKTNISQKEILDTLARVRIILIEENNGLFLTMLDDLVSRVELFGLFFATLD
IRQDSSVHGPLLDCIAEKTDLLPKNYKDLPDNEKITHLLNIKGTANPEVLEDSLHKDTLA
TIAAVKDIQQNNGEFGCHRYIISHSMNALNVMEVYGLFLASGWQKDRLSVDIVPLFETID
DLRQAGNVMRELYDNAAYRAHLKKRYNKQTIMLGFSDGTKDGGYLMANWSIYKAKQELTR
ISREYEIDVVFFDGRGGPPARGGGKTHQFYASMGRDIANEEIQLTIQGQTISSNFGTVDS
AQFNIEQLVHAGIANELFSSREQTMSGAGEALLQSLADEGYVAFNKLKHHPDFLDYLDFA
SPLRYYAETNIGSRPSKRNAAAKLNLNDLRAVPYVGAWSQLKQNVPGFYGVGSALEALEK
AGKWEELRQLYKDSLFFRTLLGNCQMAMKKSYFPLTAAYGKHPRFGEVWNMIHDEHKRTR
TLILKLVGETELMAAYPIDALSIQMRERIVLPLLTIQQAALARIRELNEAGNGDGLKETY
EKLVVRCSFGIINAGRNSA
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaccggttaataataccttacagttgttcaagaacctggttggcaccaagttc
cagttatacaatagtctttttaccgcattaccttttcataaggtagagagaaccggcgta
tttctgtcattatttcttatccactgtgaagaagggtacgctaaagaaaaaagtccccag
gaaattctcaattcttattttcagcagtacacatcctgcagcaatgaacagcagaagctg
gatctcatgttccgtttcgtgcagtatgctgagcgtcaggtagtattgtttgacgcgctg
gaagatgcagcattccgtcagatccacgatgtgcatggagcaggtaccctgagtcacctg
ttgtccgagatcacctcagagcaggcgggagagcagcttgcgaagaaattacaggattat
tccgtacgactggtactcaccgcacatcccacacagttctaccccggtggcgtactgacc
attatcaacgacctgtcaagggcgctgatcaatgacaatactgcccaggtaaatgcatat
ctccagcagctgggtaaaacacctttctttaagaaggaaaaacctaccccttatgatgag
gccatcagcctgatctggttcctggaaaatacgttctaccctgccgccggacgtattatt
tccaaactcaagtcacaattccccgctgctgtcaatagtaataatcctgttatcaggatg
ggcttctggcctggaggagaccgtgatggtaacccgtttgtaacggctgatatcacctta
cggacagcagaagctttacgtggtggtattattaaatgttactatctcgatgtgcgccgc
ctgaaacgtcgtctgactttcaaaggcattgagcaggagctgaatatgctggaagaaaag
ttgtacaacaacctttttattccgggacacaaaacaaatatcagtcagaaagaaatactg
gataccctcgcaagggtccgtattatactcatagaagaaaacaacggcctgttcctcacg
atgctggatgacctggtaagccgcgtggagctcttcggtttgttcttcgctacactggat
atccgccaggatagctctgtacatggtcctttactggattgtatcgcagagaaaacagac
ctgctgccgaagaattataaggatctccctgataatgagaagatcacgcacctgctgaat
atcaaaggaaccgcaaatccggaagtgctggaagattccctgcacaaggatacgctggct
acgatcgcagcagtgaaagatatccagcagaacaacggtgaattcggttgtcaccgttac
atcatcagccacagcatgaatgcgctgaacgtcatggaagtatatgggctgttcctggct
tccggatggcagaaagaccgcctgagcgtagatatcgtgccgctgtttgaaaccatcgat
gaccttcgccaggcaggtaatgtgatgcgtgaactgtatgataatgctgcctacagagcg
cacctgaaaaaacgctataacaagcagacgatcatgctcggcttctctgacggtaccaaa
gatggtggctacctgatggctaactggagtatctacaaagcgaaacaggagctgacccgc
atctccagagaatatgagatcgatgttgttttctttgacggccgtggaggtcctcctgca
agaggtggtggtaaaacgcaccagttctacgcttctatgggacgtgatattgctaacgaa
gaaattcagctcaccatacagggacaaaccatcagttccaacttcggaaccgtggattct
gcccagttcaacatcgaacaactggtacatgccggtattgccaatgaactgttctcttcc
cgggagcagacaatgtccggagccggagaagcgctgttacagtcacttgctgacgaaggg
tatgttgcctttaacaaactgaaacatcaccctgacttcctggattacctggatttcgcc
agtccgctgcgttactatgcagaaaccaatatcggtagccgtccatccaaaaggaatgct
gctgccaaactgaatcttaatgacctcagggcagtaccttatgtgggtgcatggagccag
ctgaaacagaacgtacctggtttctacggtgtaggctctgcactggaagcactggagaaa
gcaggcaaatgggaggagctcagacagttgtacaaagactccctgttcttccgcacacta
ctgggtaactgccagatggccatgaagaaaagttatttcccgctcaccgctgcgtatggt
aaacacccccgctttggtgaagtgtggaatatgatccatgatgagcacaaacgtacccgt
accctgatcctcaaactggtgggagaaacagaactgatggccgcttatccgatagatgcc
ctgtctatccagatgcgtgagcgtatcgtattaccattgctcacgatacagcaggcagca
ctggcacgtatacgcgaactgaatgaagccggtaatggtgatggactgaaagaaacatac
gaaaaactggtcgtacgttgctccttcgggatcatcaacgccggtagaaattctgcctga

DBGET integrated database retrieval system