KEGG   Chrysemys picta (western painted turtle): 101930790Help
Entry
101930790         CDS       T04662                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cpic  Chrysemys picta (western painted turtle)
Brite
Enzymes [BR:cpic01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     101930790 (ACE)
Peptidases [BR:cpic01002]
 Metallo Peptidases
  Family M2
   101930790 (ACE)
Exosome [BR:cpic04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101930790 (ACE)
CD molecules [BR:cpic04090]
 Proteins
  101930790 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1290 aa AA seqDB search
MPPALRLLLLCLGGAAALEAGFLPPNTDASEPGAALFAQDYNSSAEGVLFRSVSASWDYN
TNLTKPNAERQILASLEEQNFTEAWGKKAKELYGSIWKNFTDTQLKSIIGSIQTLGPSNL
PLDKRQQYNTLLSEMDNIYSTAKVCPPNQTSNCWALEPEITDIMANSRSYKKLLYAWEGW
HSSAGNPLRPKYEEFVTLSNEAYRMDGFKDTGAYWRSWYDSPTFEDDLEELYHQLEPLYL
NLHAFVRRKLYERYGPKYINLQGPIPAHLLGNMWAQQWNNIYDMMVPFPGKPNLDVTSTM
VQQNWNATHMFRVSEEFFTSLGLLAMPPEFWEKSMLEKPADGREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTFRSGANPGFHEAIGDVMSLSVSTPG
HLKKIGLLSQVTQDAESDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGRTPPSRYNYDW
WYLRTKYQGICPPISRNETNFDPGAKYHIPGNTPYIRYFVSFILQFQFHKALCQAANHTG
PLHTCDIYMSKEAGAKLSEVLKAGSSKPWQEILFNLTGKEKMDAGALLEYFSPVTTWLQK
QNNERNETLGWPDFEWRPPVPEGYPDGIDKIADEAQAKAFLAEYNSTAEVVWNAYSEASW
AYNTNITDHNKQIMLEKNLEMSAHTLKHGMQARQFDYSDFQDQSVRRVLKKLSDIERAAL
PELELKEYNNILSDMETTYSVAKVCKGQGKCYPLDPDLTDILAKSRNYDELLFSWKGWRD
ASGKEIKSKYKRYVELSNKAARLNGHPDNGAFWRSLYETPTFEADLERLYQQLQPLYLNL
HAYVRRALYNKYGQERINLKGPIPAHLLGNMWAQSWSNIFDLVVPYPSATKVDATPAMQK
QGWTPERMFQESDKFFTSLGLIPMPPEFWAKSMIEKPAGREVVCHASAWDFYNRKDFRIK
QCTVVNMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVSTPKHLH
SISLLDQVEDNNESDINYLMSIALDKIAFLPFGYLMDQWRWKVFDGRIREDEYNQQWWNL
RLKYQGLCPPVPRSEDDFDPGAKFHIPANVPYVRYFVSFVIQFQFHQALCKAAGDTGPLH
KCDIYQSKEAGTLLANAMKLGFSKPWPEAMQLITGQPNMSADALMTYFKPLTDWLIQENT
RTRETLGWPEYNWTPYAGTSNSSGGGQAQSSANAKVNFLGMSLDSNQAAAGQWILLVLGL
LLFIATIILGVKFRSSRRRAHKSSSQMELK
NT seq 3873 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagctctgcggctgctgctgctctgtctcggcggggcggctgccttggaagcc
gggttcctgccccccaacaccgacgccagcgagcccggggctgccctcttcgcgcaggac
tacaacagctccgccgagggggtcctgttccggagcgtgtccgccagctgggattacaac
accaacctcaccaagcccaacgccgagcgccagatcttggcctccctggaggagcagaac
ttcacagaggcctgggggaagaaagcgaaggaactctatggctccatctggaagaatttc
acagacactcagctgaagagtatcattggctccatccagaccctggggccttccaacctg
cccctggacaagcgtcagcagtacaacaccctcctgagcgagatggacaatatctattcc
accgccaaggtgtgtcctccaaaccagacctccaactgctgggctctggagccagagata
accgacatcatggccaactcccgcagctacaagaagttgctctacgcctgggagggctgg
cacagctcagctggaaaccccctgaggcccaagtatgaggagtttgtgacgctgagcaac
gaggcctacaggatggacggtttcaaggataccggcgcttactggcgctcctggtacgac
tcgcccacgtttgaggacgatctggaggaactctaccaccagctggagcccctctacctg
aacctccacgcctttgtcaggaggaagctgtatgaacgctacggccccaagtacatcaac
ctccagggccccatccctgctcatttattgggcaatatgtgggcccagcagtggaacaac
atctacgatatgatggtccctttcccgggcaaacccaacctggacgtcaccagcaccatg
gtgcagcaaaactggaacgcgacgcacatgttccgggtctccgaggagttcttcacctcg
ctggggctgctggcgatgccgccggagttctgggagaagtccatgctggagaagccggcg
gacggtcgggaggtggtgtgtcacgcctccgcctgggacttctacaaccgcaaggacttc
aggatcaagcagtgcactacggtcaccatggagcagctcttcacggtgcaccacgagatg
ggccacgtcgagtactacctgcagtacaaggaccagccggtcaccttccgcagcggggcc
aaccccggcttccacgaggccatcggcgacgtcatgagcctgtcggtctccactcccggc
catctcaagaagatcgggctcctcagccaagtcacccaggacgcagagagtgacatcaac
tacctgctgaaaatggccttggagaagattgccttcctccccttcggttacctcatcgac
cagtggcgctggaatgtcttcagtggccgcaccccgcctagccgctacaactacgactgg
tggtatctgagaactaaatatcagggcatctgtcctcccatttcaaggaacgaaaccaac
tttgaccctggtgcaaagtatcacatccccggcaacaccccctacatcaggtactttgtg
agttttatcctgcagttccagtttcacaaggccctgtgccaagctgccaatcacaccggc
cccctgcacacctgtgacatctacatgtccaaagaggcgggagcgaaactcagtgaggtg
ttgaaagctggctcttccaagccgtggcaagagatcctctttaatctgactggcaaggag
aagatggacgctggggccctactggagtacttcagccctgtgacaacgtggcttcagaaa
cagaacaacgaaaggaatgaaacactgggctggccggacttcgagtggcgcccgcctgtc
cctgagggctaccctgacggcatcgataaaatagcggatgaagcacaagccaaagccttc
ttggcggagtacaacagcacggccgaagtggtgtggaacgcctacagcgaggcgtcctgg
gcgtacaacaccaacatcacggaccacaacaagcagatcatgctggagaagaacctggag
atgtcagcccacaccctgaagcacggcatgcaggcccggcagttcgactactctgacttc
caggaccagagcgtcaggcgcgtcctgaagaaactgagcgacattgagagagccgccctg
ccggaactagagctgaaggagtacaacaacatcctctcggatatggagaccacatacagc
gtagccaaggtctgcaagggacagggcaagtgctatccattggatcctgacctcaccgac
atcctagccaagtcgcggaattacgacgagctcctcttctcctggaagggctggcgggac
gcctctgggaaggaaatcaaaagcaaatacaagagatacgtggagctaagcaacaaggca
gccaggctcaatggtcacccggacaacggggccttctggagatccctctacgaaacgccc
accttcgaagcggacctggagcggctctaccagcagctgcagcccctgtacctcaacctg
catgcctacgtgcgccgcgccctctacaacaaatacgggcaggagcgcatcaacctgaag
ggtcccatcccagctcacctgctcgggaatatgtgggcccagtcgtggtccaacattttt
gacctggtggtgccctaccctagtgccactaaagtggatgccaccccggccatgcaaaaa
cagggctggaccccggagaggatgtttcaagaatcggataagttctttacctccctgggc
ctgatccccatgccgccggagttctgggccaagtccatgattgagaagccagccggccgg
gaggtggtgtgccacgcctctgcctgggacttctacaaccgcaaggacttcaggattaag
cagtgcacggtggtgaacatggacgacctgatcaccgtccaccacgagatggggcatgtc
cagtacttcctgcagtacaaggaccagcccatctccttccgcgacggggccaaccccggc
ttccatgaggccatcggcgacgtcatggccctgtcggtctccacgcccaagcacctgcac
agcatcagtctgctggatcaagtggaggataacaacgagagtgacattaactacctgatg
agcattgccctggataaaatcgccttcctgcccttcgggtacctgatggaccagtggcgc
tggaaggtgtttgacgggcgcattcgggaggacgaatataaccagcagtggtggaacctc
aggttgaagtaccaggggctgtgcccacctgtgcccaggtcggaggatgactttgatcct
ggtgcgaagtttcacatcccggccaacgttccctatgtcaggtactttgtcagttttgtg
atccagttccagttccaccaagccctctgcaaagccgccggtgacaccgggcccctgcac
aaatgtgacatctaccagtccaaggaagccggaaccctgctggcgaacgccatgaagctg
ggcttcagcaagccctggccggaggccatgcagctcatcacggggcagcccaacatgtcg
gccgacgccctgatgacctacttcaagccgctgacggactggctgatccaggagaacacg
aggaccagggagaccctgggctggcctgagtacaactggacgccgtatgcgggtacttcc
aactccagcggagggggtcaagcacagtctagtgccaatgccaaagtcaatttcctgggg
atgtcgctggatagcaaccaagccgccgcaggccagtggattctgcttgtcctcggactc
ctcctcttcattgccaccatcatcctgggcgtcaaattccgctcctcaaggagaagggcc
cacaaatccagctcacaaatggaactgaagtaa

DBGET integrated database retrieval system