KEGG   Chryseobacterium piperi: CJF12_14200Help
Entry
CJF12_14200       CDS       T05071                                 

Definition
(GenBank) superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cpip  Chryseobacterium piperi
Brite
Enzymes [BR:cpip01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CJF12_14200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ASW75324
UniProt: A0A086BF90
LinkDB All DBs
Position
3220004..3220507
Genome map
AA seq 167 aa AA seqDB search
MNVQKLVLLTGFALFAVSCGTAKTYMVNAKSGTQTGGTAKFTQKGDEVIMKLDVTNLTPG
IHAVHIHEKGDCSAADGTSTGGHWNPAKDDHGKWGAEHFHMGDIGNLVADQTGTATLTFK
TTKWCLGCADESKNIIGKGLIVHADKDDFHTQPTGNAGGRVGCVEIK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtacaaaaattagtattattaacaggatttgcgttatttgctgtttcttgcgga
acagcaaaaacgtatatggtgaacgctaaaagcggaactcagacaggtgggactgcaaag
ttcacgcaaaaaggagacgaagttatcatgaaacttgatgtaaccaatctaactccgggt
atccacgctgtacatatccacgaaaaaggagattgctctgctgctgacggaacttctaca
ggaggacactggaatccggctaaagatgatcacggaaaatggggagctgaacatttccac
atgggagatatcggtaacttagtagcagatcagacaggaacagcaacactaactttcaaa
acaaccaagtggtgtcttggatgtgcagatgagtctaaaaacattatcggaaaagggctt
atcgtacatgcagataaagatgatttccatacccagccaacaggaaatgcgggtggaaga
gtaggatgtgtagaaattaaataa

DBGET integrated database retrieval system