KEGG   Corynebacterium pseudotuberculosis 3/99-5: Cp3995_1128Help
Entry
Cp3995_1128       CDS       T01689                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cpl  Corynebacterium pseudotuberculosis 3/99-5
Pathway
cpl00620  Pyruvate metabolism
cpl00680  Methane metabolism
cpl01100  Metabolic pathways
cpl01120  Microbial metabolism in diverse environments
cpl01200  Carbon metabolism
Module
cpl_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cpl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cp3995_1128 (ppc)
  Energy metabolism
   00680 Methane metabolism
    Cp3995_1128 (ppc)
Enzymes [BR:cpl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cp3995_1128 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEX39592
LinkDB All DBs
Position
complement(1204908..1207589)
Genome map
AA seq 893 aa AA seqDB search
MSVKATSAGPLSEQLVEDIRFLGALLGEVIKEQEGIAAFDRVEAARQLAFKISRKESQVE
DLVALLKDISAADAIPIIRAFSHFALLANMVEDLHDELGRLQRQEAGEQDPDSTLGATWK
KLANAGITNEKVSSLLSNFQVAPVLTAHPTETRRRTIFDAQEHMTTLLKKRHAILSSETN
ALTTARLEENTRHIRRWLTLIWQTALIRVARPRIEDEVEVGLRYYELSLLTAIPEINKQV
ADHIQREYGVNSEDALQSLLIKPGSWIGGDHDGNPYVTAGTLHYATTRAAETVLKFYVHG
VRGRVLATLASRIGPETVEGSWYSRHAAYTAPEQLAADLDIIDASLRRTHDELIADDRLL
RIRTAVSSFGFHLYSMDLRQNSESYEDVLTELFERAQVTPHYRKLDESEKISVLIAELSS
PRPLIPRDGLPYSELTQRELDIIFEAKQAVDAFGTMMIPHSIISMAESASDILEPMVLLK
EFGLIKIQEGHLTGHIDVIPLFETIDDLQNGAKILQDLWQIPLYRSYLEQRGNLQEVMLG
YSDSNKDGGYLAANWALYAAETDLVNICKQHGIALRLFHGRGGTVGRGGGPSYEAILAQP
HGAVQGSVRVTEQGEIISAKYGSAGAARRNLEALASATLEASLLKIDQVEEQYPEAYEIM
GEISRLSQKKYSRLAHEDPGFIEYFTSSTPLEEIGELNIGSRPSSRKQTKSIDDLRAIPW
VLSWSQSRVMLPGWYGVGSALHEWIEKGCAQTAELSPDERLVVLQELNSSWPFFSSVLSN
MAQVMSKAEMQLAKLYSGLVADQEAANRIFSDISAEFELTKKMFLKITGFSGLLDDNPML
ARSVRSRYPYLLPLNTLQLEMLRRYRKGDDDPKVVHGIRLAMNGLATALRNSG
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaagctacgtctgcgggtccactatccgaacaacttgttgaggacatacgc
tttctcggtgctcttttaggggaggtgatcaaggaacaagaaggaatagcagcctttgac
cgggtggaggcagcaagacagctggcttttaagatttctcgtaaggaatcacaggttgaa
gacttagtggcattgctaaaggatatttcagcagcagatgcgataccaatcattagagca
tttagtcatttcgcgctactcgcaaacatggtggaggacttgcacgatgagttgggcaga
cttcagcgacaggaagccggtgaacaagatccagattcaactttaggcgccacatggaaa
aagctggcgaatgctggcataacaaatgaaaaagtttccagtttgctgagtaattttcaa
gtggctccagtgcttactgctcaccctacggaaacccgtagacgcacgatcttcgatgct
caagagcatatgactactctgcttaaaaagcgtcatgcgattcttagctctgagacaaat
gcgctgacaactgcacggcttgaagaaaatactcgtcatattcgtaggtggctgacctta
atatggcaaactgcgcttatccgtgtagcccgtcctcggattgaagatgaggtagaagtt
gggttgcgttattatgagctctctttactcactgcgatccctgagatcaataagcaagtg
gctgatcacatccagagagaatatggtgtgaactccgaagatgctttgcagtcactattg
attaagcccggaagctggatcggtggcgatcatgacggtaacccgtatgtcactgcagga
actctgcactacgcgacaacgcgagccgccgagactgttttaaagttttatgtccatggt
gtacgtggtcgagtacttgccacactagcttctcgaatcggcccagaaacagtagaaggc
tcatggtattcccgccatgctgcgtatactgcacctgagcaactcgcagctgatttggac
attatcgatgcttctttgcggagaactcacgatgagctcatcgcagatgatcgtctgctg
cgcatacggacagcagtatcgagctttggtttccatctttactcgatggatctgcgtcaa
aactctgagagttacgaggacgtgcttactgagctctttgagcgggcccaagtaactccg
cactatcgaaaattagatgagagcgaaaaaattagcgttttgatcgccgagctatcctcg
ccaaggcctctcattccgcgcgatggcttgccgtacagcgagttaacgcagcgggaactc
gatattatttttgaggcaaagcaagccgtggatgcctttggaacaatgatgattccacac
tctattatttcgatggcagaatctgcgagcgacattctcgagccaatggtcctactgaaa
gaatttggattaatcaagattcaagaaggccatctcacagggcatattgacgttatacct
ctttttgaaacaatcgatgacctacaaaatggtgcaaagattctccaagatttgtggcag
ataccgttgtatcgcagttatttagagcaacgaggcaatctccaggaagtgatgctcggt
tattccgattccaataaagatggtggctaccttgccgcaaactgggctttatatgcggca
gaaactgaccttgtaaacatatgtaagcaacatggtattgctctgaggcttttccacggg
cgtggtggcaccgtagggcgtggtggcggtccctcttatgaggcaattctcgctcagcca
catggtgcggtgcaaggtagcgtacgcgtcacggagcaaggcgagattatctcggcaaaa
tacggttctgcgggagctgctcgccgtaatctggaggctctggcctcagccacattggaa
gcttctttgctcaagatcgatcaagtagaagaacagtatcctgaggcctatgaaattatg
ggcgaaatttcgcggttgagtcagaaaaagtattcgcggcttgctcatgaagatcccgga
ttcattgaatatttcacgtcatcgacgcctttggaagaaataggggagctcaacatcggc
tctcgtccttcctcgagaaaacagactaagagcatcgatgatttacgcgcgattccctgg
gtgcttagttggtcgcagtcacgtgtcatgcttcccggttggtatggagtaggcagtgct
ctacatgaatggatagagaaggggtgcgcgcagacagcggaactatctccggatgaacgt
ctcgtggttctgcaagagcttaattcttcctggccattcttttcttcggtgttgtctaat
atggcgcaggtgatgagtaaggctgagatgcagctcgccaagctctactcagggctagta
gcagaccaagaagccgcaaacaggatattctccgatatctctgctgaatttgagcttact
aagaaaatgttccttaagattaccggtttttcggggcttctcgacgacaaccctatgctc
gcacgatcagttcggtcccgctatccatacttgctacctcttaatacgctgcaacttgaa
atgttacgtcggtatcgcaagggggatgatgaccctaaggtagtgcatggtattcgtctg
gctatgaacggcttggccaccgcgctgcgaaattctggttag

DBGET integrated database retrieval system