Cavia porcellus (domestic guinea pig): 100730350 Help Entry 100730350         CDS       T07777                                  Symbol Fgf4 Name (RefSeq) fibroblast growth factor 4   KO K04358   fibroblast growth factor Organism cpoc  Cavia porcellus (domestic guinea pig) Pathway cpoc04010   MAPK signaling pathway cpoc04014   Ras signaling pathway cpoc04015   Rap1 signaling pathway cpoc04020   Calcium signaling pathway cpoc04151   PI3K-Akt signaling pathway cpoc04810   Regulation of actin cytoskeleton cpoc05200   Pathways in cancer cpoc05207   Chemical carcinogenesis - receptor activation cpoc05218   Melanoma cpoc05224   Breast cancer cpoc05226   Gastric cancer Brite KEGG Orthology (KO) [BR:cpoc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100730350 (Fgf4)    04014 Ras signaling pathway     100730350 (Fgf4)    04015 Rap1 signaling pathway     100730350 (Fgf4)    04020 Calcium signaling pathway     100730350 (Fgf4)    04151 PI3K-Akt signaling pathway     100730350 (Fgf4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100730350 (Fgf4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100730350 (Fgf4)    05207 Chemical carcinogenesis - receptor activation     100730350 (Fgf4)   09162 Cancer: specific types    05226 Gastric cancer     100730350 (Fgf4)    05218 Melanoma     100730350 (Fgf4)    05224 Breast cancer     100730350 (Fgf4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cpoc04052]     100730350 (Fgf4)    00536 Glycosaminoglycan binding proteins [BR:cpoc00536]     100730350 (Fgf4) Cytokines and neuropeptides [BR:cpoc04052]  Cytokines   Growth factors (RTK binding)    100730350 (Fgf4) Glycosaminoglycan binding proteins [BR:cpoc00536]  Heparan sulfate / Heparin   Growth factors/receptors    100730350 (Fgf4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  100730350 NCBI-ProteinID:  XP_003468371 Ensembl:  ENSCPOG00000013920 UniProt:  H0VPV0 LinkDB All DBs Position Unknown AA seq 206 aa AA seqDB search MVGPGTVAAALLPGLLLALLGPWAGQGGAAAPTAPNDTLEAELERRWESLVARSLARLPV AAQPQEAVVQSGAGDYLLGIKRLRRLYCNVGIGFHLQVLPDGRIGGVHADTADSLLELSP VERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECKFKETLLPNNYNAYESHSYAGMFIA LSKNGRTKKGNRVSPTMKVTHFLPRL NT seq 621 nt NT seq  +upstreamnt  +downstreamnt atggtggggcccgggacggtcgcggcggcgctgctcccggggctcctgctagcccttctg gggccctgggcgggccaagggggcgcagctgcgcccaccgcacccaacgacaccctggag gccgagctggagcgccgctgggagagcctggtggcgcgctcgctggcgcgcttgccggtg gccgcgcagccccaggaggcggtcgtccagagcggtgccggcgactacctgttgggcatc aaaaggctgcggcggttgtactgcaacgtgggcatcggcttccacctccaggtgctcccc gacggccgcatcggcggcgtgcacgcggacaccgccgacagcctcctggaactctccccg gtggagcgaggggtcgtgagcatcttcggagtggccagccggttcttcgtggccatgagc agcaagggcaagctctacggctcgcctttcttcaccgatgagtgcaagttcaaggagacc ctcctccccaacaactacaacgcctacgagtcccacagctacgctggcatgtttatcgcc ctgagtaagaacgggaggaccaagaagggaaaccgcgtgtctcccaccatgaaggtcacc cactttctccccaggctgtga

DBGET integrated database retrieval system