KEGG   Clostridium perfringens SM101: CPR_0877Help
Entry
CPR_0877          CDS       T00379                                 

Gene name
nanH
Definition
(GenBank) exo-alpha-sialidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
cpr  Clostridium perfringens SM101
Pathway
cpr00511  Other glycan degradation
cpr00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:cpr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPR_0877 (nanH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPR_0877 (nanH)
Enzymes [BR:cpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CPR_0877 (nanH)
Bacterial toxins [BR:cpr02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CPR_0877 (nanH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_3 BNR_2 BNR DUF4185
Motif
Other DBs
NCBI-ProteinID: ABG86307
UniProt: Q0SUK5
LinkDB All DBs
Position
complement(1012783..1013931)
Genome map
AA seq 382 aa AA seqDB search
MRNKNNTFEKNLDISHKPEPLILFNKDSNIWNSKYFRIPNIQLLNDGTILTFSDIRYNGP
DDHAYIDIASARSTDFGKTWSYDVAMKNNRIDSTYSRVMDSTTVITNTGRIILIAGSWNT
NGNWAMTTSARRSDWSVQIIYSDDNGLTWSNKIDLTKDSSKVKNQPSNTIGWLGGVGSGI
VMDDGTIVMPAQISLRENNENNYYSLIIYSKDNGETWTMGNKVPNSNTSENMVIELDGAL
IMSTRYDYSGYRAAYISHDLGSTWEIYEPLNGKVLTGKGSGCQGSFIKATTSNGHRIGLI
SAPKNTKGEYIRDNIAVYMIDFDDLSKGVQEICIPYPKDGNKLGGGYSCLSFKNDHLAIV
YEANGNIEYQDLTPYYLLIDKE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacaaaaacaacacctttgaaaaaaatctagatataagccataaaccagaacca
ctaatactatttaacaaggatagtaacatatggaattcaaagtattttagaattcccaat
atacaattattaaatgatggcacaattttaaccttttcagatattcgttataatggccct
gatgaccatgcttatatagacatagcttctgcacgcagtactgattttggaaagacatgg
agctatgatgtagcaatgaaaaataatcgtattgactctacttattctcgtgtaatggac
tccacaacagttattacaaatacaggtagaataatattaattgcaggctcatggaataca
aatggaaactgggcaatgactacttctgcaagaagaagtgattggtctgttcaaattatt
tattctgatgataatggattaacttggtctaacaaaatagatttaaccaaggactcatca
aaagtaaaaaatcaaccaagtaatacaattggatggctaggaggagttggctcaggtatt
gtaatggatgatggaacaatagttatgccagcacaaatttccttaagagaaaataatgaa
aataactattattcattaattatctattcaaaggataatggtgaaacatggacaatggga
aacaaggttcctaattcaaatacttctgaaaatatggtcatagaattagatggagcttta
attatgagtacaagatatgattactctggttatagggcagcatacatctctcacgattta
ggaagcacctgggaaatatatgaacctttaaacggtaaagttttaactggtaagggctct
ggatgccaaggttcatttattaaagctactacttcaaatggacatagaataggattaatt
tcagcacctaaaaacactaaaggtgaatatataagagacaatattgctgtttatatgatt
gactttgatgatttatctaaaggtgttcaggaaatatgtattccttaccctaaagatggt
aacaaattaggcggtggctattcttgtctatcctttaaaaatgaccatttagccattgtt
tatgaagccaacggaaatatagaatatcaagacttaacaccttattacttactaattgat
aaagaataa

DBGET integrated database retrieval system