KEGG   Corynebacterium pseudotuberculosis Ft_2193/67: CPTC_00270Help
Entry
CPTC_00270        CDS       T03484                                 

Definition
(GenBank) Sialidase
  KO
K01186  
sialidase-1 [EC:3.2.1.18]
Organism
cpsf  Corynebacterium pseudotuberculosis Ft_2193/67
Pathway
Other glycan degradation
Brite
KEGG Orthology (KO) [BR:cpsf00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CPTC_00270
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CPTC_00270
Enzymes [BR:cpsf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     CPTC_00270
Bacterial toxins [BR:cpsf02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   CPTC_00270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(275800..277884)
Genome map
AA seq 694 aa AA seqDB search
MTDSHRRGTRKALVTLTAALALTTQGLTAPATLAEEGSTIVPAPIDNNGLFDAAPPAPVA
RGAVGEGKLPDPVTSEFFDSKVIRDVDPAGQRCFRIPAIATAVDGTLLVAFDNRYGPDAQ
SRTWCRDAPYENTKRNSREKQTDIEIYRSHDSGKSFEEGDFIAKGTEDPRDLSYTDPSIV
VDHETGKIFAVFVRGYDYRFFDATAGVNRGSVEDPIQKRSVQDTVIIESNDNGQTWGNMK
LLSELTEKIKVRHKPGQELAGRGRFATSGNGIQLKYGENAGRLLFPMSVHYSPNGAGAVA
NVALYSDDHGATWNVGQGVGGEGETNGDENKLVELSDGRIMMNSKSTGSNPSNPRGAERW
RSYSEDQGETWSKPEPVIVAPPQHPLQRNTGINVSLIKAYPSAPEGSAAARVLLYSAPID
TRIKGEYGQDGRSNGWVMASCDDGRSWTHGRQIEAGRFQYSVMTPMADGNIGMVYESGDK
ERGMTLKFAKFNMAWLGADCLSNKALGITDLPDPALAKAIEDAKAATAKAEEATANVLKL
TKELEEAELENEELAQALAEAKSAAQDAIAAAEEANARVKAAEGATIEAEEAAMKAENEA
KALAEQLAKVEAELANSQDQAKALAEAKEAAEIARKAAEEALKLEKEKSGKAGGTDNTEN
KGFWQELLRIFPGFAPIFSFLASIWGGMQKLLAF
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgacggattcacaccgccgtggaactcgcaaagcgctggtaacactcacagcagcgctg
gcgctcaccactcaaggccttacggctcctgcgactcttgctgaagagggttcgaccatc
gtacctgcgcccattgataataatgggcttttcgacgctgccccgcccgcgcccgtagcg
cgtggtgcagtgggggagggtaagcttcccgaccctgtaaccagcgaattttttgattcg
aaggttatcagagacgtagacccggcagggcagcggtgcttccgtattccggctatcgct
acggcagtagacggaactcttttggtggcttttgataaccgctatggaccagatgcgcag
agcaggacctggtgtagggatgcgccttacgagaacacgaaacgtaattcgcgtgaaaag
cagacggatattgagatttatcgctctcatgattccggtaaatcctttgaggagggcgac
ttcattgccaaggggaccgaggatccgcgggatctttcctataccgatccctcaatcgtt
gtagaccatgaaacagggaagatatttgcagtctttgtgcggggttatgactaccgcttc
tttgatgcgactgcaggtgtaaatagaggttccgttgaagatccaatacagaaaaggtcg
gttcaggataccgtcataattgaatcgaacgacaacggtcaaacctggggaaacatgaag
cttctcagcgagttgacggagaaaattaaagtccggcacaagcctgggcaagagcttgcg
ggtcgtggaagatttgcgacttctggtaacggaatccaattaaagtacggggaaaatgcg
ggacggttacttttcccaatgtcggtgcactacagcccaaatggtgctggggctgtagca
aacgtagcgctttattccgatgaccatggggcgacctggaatgttggacaaggcgtcggg
ggcgagggagagacgaacggggatgagaataagctagtggagctttccgatggtcgaatc
atgatgaattcgaagagtacgggaagtaatcctagtaatccgagaggcgcagagcgttgg
aggtcttattcagaggatcagggagaaacctggagtaagcctgaaccggtaatcgttgcg
ccacctcagcacccattgcaaagaaatactggtatcaatgtttctctgattaaggcatac
cctagtgccccggaaggcagtgctgccgcgcgggtgctcttgtactctgctccgattgat
acccgaattaaaggagaatacgggcaagacgggcgtagcaatggttgggtcatggcctcc
tgtgatgacggtaggtcgtggacgcacgggcgtcagatcgaagctggccgttttcagtac
tcggtcatgactcctatggctgacggcaatattggcatggtgtatgaatctggcgataag
gaaaggggaatgaccctcaagtttgccaagttcaacatggcttggctgggagccgattgc
ttgagcaacaaagccttgggtattaccgatttgccggatcctgctttggctaaggctatt
gaagacgcgaaggctgcgacggctaaggctgaggaagctacggcgaacgtgctaaagcta
actaaggaactagaagaagccgagcttgaaaacgaagagcttgcacaggctctggctgag
gctaagagcgcagcacaggatgctatcgctgccgctgaggaggctaatgctcgggttaaa
gcagctgagggagctacgattgaggctgaagaagctgcaatgaaagcagagaatgaggct
aaagcgttagcggaacaattggctaaggttgaggcggagctagcaaattcccaagatcaa
gccaaggccttggctgaggctaaagaggctgctgagattgctcggaaggcagcggaagag
gcccttaagctggaaaaggagaagtctggaaaagccggcggtacagataacactgaaaat
aaaggtttttggcaagaacttttacggatttttccgggatttgcacctattttcagtttc
ctagcgtcgatatggggcggcatgcagaagctgctggcattttaa

DBGET integrated database retrieval system