KEGG   Coniophora puteana: CONPUDRAFT_82993Help
Entry
CONPUDRAFT_82993  CDS       T03134                                 

Definition
(RefSeq) hexokinase
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cput  Coniophora puteana
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cput00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CONPUDRAFT_82993
   00051 Fructose and mannose metabolism
    CONPUDRAFT_82993
   00052 Galactose metabolism
    CONPUDRAFT_82993
   00500 Starch and sucrose metabolism
    CONPUDRAFT_82993
   00520 Amino sugar and nucleotide sugar metabolism
    CONPUDRAFT_82993
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CONPUDRAFT_82993
Enzymes [BR:cput01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CONPUDRAFT_82993
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
LinkDB All DBs
Position
Unknown
AA seq 498 aa AA seqDB search
MPASRRGSGSVILPSGQTIALHTRTHDEEDLPHATKKTMADHLRRFENLFTLTPQRMRMI
VEAFTETLEVGLNKPNQVVPMIPTFVFGWPTGSEKGDFLALDLGGTNLRVCLVTLQGEGK
FEITQTKYRLTEEQKQDDGQKLFDFCAECLKTFVDTNSGDGPGQLKPGQILPLGFTFSYP
CSQERIDHGELIRWTKGFGAPNTEGRDVAEMFKKSLAKFELPITLTALINDTTGTLVASH
YVNPKTKIAVIFGTGCNAAYMEHVKDIGKIKSLGIDEDADMAINCEWGAFDSFEHEHLPR
TKYDVVVDEASNKPGEQAFEKLISGRYLGEIFRVVVCELIDEGVLFLGQNTYKLEKPYII
DTAFLSLMESDPTDELLMIIGIFTHFFNIETTLAERQFFRALAKLIGRRAARMSACGIAA
IVNKMGYIEEGCAVGADGSLYNKYPMFPERVHEGLVDIFGDKGRNIVTHHAEDGSGVGSA
IIAAMTKIRKDAGLYTNV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgtctcgtagaggaagcgggagtgtcatcttgccgtctgggcagacgattgcg
ttgcacacaaggacccacgatgaggaggatctcccccatgctaccaagaagacgatggcc
gaccatctgcggagattcgagaatctgtttacgctgaccccgcagcggatgcgcatgatc
gtcgaagcatttacagagacacttgaggttggcttgaacaagccaaaccaggttgtgccc
atgatccccaccttcgtctttggctggccaacaggctcagaaaagggagatttccttgct
cttgatcttggtggaaccaacctccgcgtttgtctcgttaccctccaaggcgagggcaaa
ttcgagatcacgcagaccaagtaccgccttaccgaggagcagaagcaggatgatggccag
aagctgtttgatttctgtgcggaatgcctgaagacgttcgtcgatacgaactccggggac
gggcccggccagcttaagcctgggcagatcttacctcttggttttacgttctcgtacccc
tgctcccaagaacggattgaccacggcgagcttatccgctggacaaagggtttcggcgcg
ccaaacaccgagggcagggacgtggccgagatgtttaagaagtcccttgcaaaattcgag
cttcccattacactgactgcacttatcaacgacacgactggaacattggttgcgtcccac
tacgtgaatccaaaaacgaagatcgctgtcatcttcggaacgggttgtaatgccgcatat
atggagcacgtcaaggacattggcaagattaagtcgctgggtattgacgaggacgcggat
atggcgattaactgcgagtggggcgccttcgactcgtttgagcatgaacacttgccacgg
acgaaatacgatgtcgtcgttgacgaggcgtcaaacaagcctggagaacaagctttcgag
aaactcatctccgggcgctacctcggcgagatcttccgtgttgtcgtgtgcgagctaatc
gatgaaggagtcctcttcctgggccagaacacgtacaagcttgaaaagccctacatcatc
gacaccgctttcttgtctctcatggagagcgacccaacggacgagcttctcatgatcatc
ggtatcttcacgcacttcttcaatattgagacgacgctagccgagcgccagttcttccgc
gcgctcgccaagctcatcgggcggcgtgctgcacgcatgtccgcgtgcggtatcgctgcc
atcgtcaacaagatgggctacattgaggagggatgcgccgtcggtgctgacggttcgttg
tacaataaataccccatgttccccgagcgcgtgcacgagggcctagtggacatcttcggc
gacaagggacgcaatattgttacccaccacgccgaagatggcagcggtgttggtagtgca
atcattgctgccatgacgaagattcggaaggatgctggcttgtacaccaacgtctaa

DBGET integrated database retrieval system