KEGG   Coccidioides posadasii: CPC735_053560Help
Entry
CPC735_053560     CDS       T01332                                 

Definition
(RefSeq) hexokinase, putative
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cpw  Coccidioides posadasii
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cpw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CPC735_053560
   00051 Fructose and mannose metabolism
    CPC735_053560
   00052 Galactose metabolism
    CPC735_053560
   00500 Starch and sucrose metabolism
    CPC735_053560
   00520 Amino sugar and nucleotide sugar metabolism
    CPC735_053560
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CPC735_053560
Enzymes [BR:cpw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     CPC735_053560
Membrane trafficking [BR:cpw04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    CPC735_053560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
AA seq 490 aa AA seqDB search
MTVTTPRRRPSRKGSMADMPKDLLEQVKELEELFTVDQARLKKIVDHFVKELEKGLSVQG
GNIPMNVTWVMGFPTGHEQGTFLALDMGGTNLRVCEIFLCEKKGEFDITQSKYRIPEELK
SGNADDLWEYIADCVQQFIEYHHEEENLPDLPLGFTFSYPATQEYIDHGVLQRWTKGFDI
DGVEGEDVVPMLEAALAKRGLPIKVAALINDTTGTLIASAYTDPEMRIGCIFGTGVNAAY
MENAGSIPKIAHYNLPPDMPIAINCEYGAFDNERVVLPLTQYDVVIDRDSPRPGQQAFEK
MTAGLYLGEIFRLVLLDLIDNKGNLIFEGQDVSSLRKPYCLDSSFLAYIEEDPFENLSET
RDLFERNLGIKATKPELELCRRLAELIGTRAARLSACGVAAICKKKNIKSCHVGADGSVF
NKYPHFKARGAKALREILDWADDEEDKVIICSAEDGSGVGAALIAALTLERVKQGNLAGI
RKTDTMKKLL
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgacggtcaccactcctcgccgaaggccgtcccggaagggatcaatggccgatatgcca
aaggacctgctcgagcaggtgaaggagctcgaggagctcttcacagtcgaccaggctcgg
ttgaagaaaatcgtggaccactttgtaaaagagctggagaaaggtctcagtgtacagggt
gggaacatccctatgaatgtcacttgggttatgggctttcccactggccatgaacagggt
acgttcctcgcgcttgatatgggcggtaccaacctccgtgtctgcgagatcttcctttgc
gagaagaagggtgaattcgacatcactcagtccaaatatcgcattccggaggagttgaag
agcggcaatgccgatgacctctgggaatacatcgccgattgtgttcagcagttcattgaa
taccaccatgaggaggaaaatttgccggacctacccctgggcttcaccttctcctatccc
gctactcaggagtatattgaccacggtgtgttacaacgatggactaagggctttgatatt
gacggcgtggagggtgaggatgttgtgcctatgttagaagcggcccttgcaaagaggggt
ctcccgatcaaagtcgctgccttgatcaatgataccaccggaactctgatcgcctctgct
tacactgatcctgagatgaggattggctgcatcttcggaacaggagttaacgcggcatac
atggagaatgcgggatccatcccaaaaatcgctcattacaaccttccccctgatatgccc
atcgccattaactgtgaatatggtgcctttgataacgagcgtgtggtacttccgttgact
caatatgacgtcgtgattgaccgtgactccccgcggcccgggcaacaggccttcgaaaag
atgaccgccggtctgtatcttggcgaaatcttccggctggtccttctagaccttattgac
aacaaaggcaatctcattttcgaaggccaggacgtcagcagcctccggaaaccgtactgc
ctagactcttccttcctggcgtacatcgaagaagatcctttcgagaacttgtctgaaacc
agggaccttttcgagcgcaatcttggaatcaaggccaccaagcctgagcttgagctctgc
cgccgcctagcagaacttattggtactcgcgctgcgcgcctctccgcttgcggtgtcgcg
gccatttgcaaaaagaagaatatcaaatcttgccatgttggagctgacggttccgtcttc
aacaaatatccccatttcaaggcccgcggagccaaggcacttcgtgagatcctcgactgg
gctgatgatgaggaagataaagtcattatatgctctgccgaggacggttctggtgttggt
gccgcactgatcgcagcgctgacgctcgagagagttaagcagggaaatctagccggcatt
cgaaagacagacacgatgaagaagctgctgtga

DBGET integrated database retrieval system