KEGG   Crassostrea gigas (Pacific oyster): 105325490Help
Entry
105325490         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105325490 isoform X1
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
Enzymes [BR:crg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105325490
Peptidases [BR:crg01002]
 Metallo Peptidases
  Family M2
   105325490
Exosome [BR:crg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105325490
CD molecules [BR:crg04090]
 Proteins
  105325490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Unknown
AA seq 3597 aa AA seqDB search
MKMHFLLIACISATFHFASGVPVSEELITDEAKAIEFLEWYNKESTKVTYSYFLKQWAYQ
TNLTDFNQQQAVNEDLVKSKFVNDAIRNASRYNWQVFSNATVKRMFWKITNVGPAALSDP
EKVKRLGAVQSEMEKIYSQALVCNVTNSSCIDMEFGLTPIMANSRDYDTLLRAWKGWRDE
TGKKIRTQYAEYVQLNNEGVREAPGGYEDMGEYLRGWYESPDLEMHLGGLLKQLQPLYSQ
LHAYVRARLQKHYPQHRFPKSGHIPAHILGNMWAQNWENIYGIVQPFKDKPEIEVTPALK
AQHFNATSIFRTAEDFFTSLELDPLPDSFWEKSMLSRPTDGREVICHPSAWDLGNSKDFR
IKMCTAVTMPELIVVHHELGHVWYYMMYKDQPLAFQEGANPAFHEAIGDLIALSVSTPAH
LKQIGLLDTVKNDEESDLNFLMAMALRKIAFLPFGYLIDQWRWSVFSGNTTQAEYNKNWW
DLRCRYQGIHPPVDRSEEDFDPGAKYHVPSGTPYIRYFLSYIMQFQFHKALCQEKNHTGP
LYTCDIYNSKAAGDKLRSALQLGSSKPWPEVMKVLTGSPKVDVGPLMEYFSPLIEWLKET
NEEEGNSLGWAPHGCPSLRTGKVEDEEAARKFAQEFNDMAEDQYSKDIEISWEYNTNITD
YNQKRVVNSSVEIAEFRKEMADLANLYDWHLFKDEKLKRLFSRITAIGTAVQDDTAKQAK
MTEVQSDMESIYSKANVCLSDGSCHQIEPGLTKLLATSKNYSLLSEAWVQWRDATGKKMK
SKYQELVKLSNEAIRLADFADIGAYWRRWYESATFQQDLENLLNQLQPLYENLHAYVRRK
LKEVYDSDIDKFPTSGHIPAHLLGNMWAQGWNNIAKYVLPYPDRESIDVSPKLKEKGYDA
KKLFKISEEFFLSLGLIGMPETFWNDSMITKPDDREVVCHASAWDFYNRKDYRIKMCTEI
NMEDLITIHHEMGHIEYFLQYKEQPLVYRDGANPGFHEAVGDVMALSVSTPEHLHEIGLL
DKLENDTETDLNFLMSMALEKVAFLPFGYLIDQWRWSVFSGNTSYTDYNKKWWELRCKHQ
GIAPPVERTSDDFDPGAKYHVPANVPYIRYFVSYVVQFQFHQALCKEAGRTDVPLHRCDI
YRSKEAGKKLSEMLKLGSSVSWQEAMEKITGQREMSAKAVLEYFQPLTDWLKKQNEGEEI
GWTGACPGNGRKRTAEVAKQWLKEYNTIAEQALYTISEVEWSYATNITDENSRKLVDARL
VYAKFNKEAAQNASQLLRELDTSLSPTERRELKKISTIGTDALKNETKLKQLNSLQSEIE
GLYGKAKVCVGHGKCLPLEPDVYKIMATSRNYSELEMVWKGWRDNSGRRMKDKYAKFVDL
SNQAIQDLNQGFKDTGDYWRSAYESATFQEDLENLLTELKPLYAQLHTYVRNQLRSLYGA
DKFPRSGHIPAHLLGNMWAQHWDNIYDIVIPFKDKTNVDVTPTMLAQNYTALRMFRTSEE
FFKSLGLKEMPQPFWDKSMIVKPPGREVVCHASAWDFYNRKDFRIKMCTDITMENLITIH
HEMGHIQYYLQYQDKPVEFREGANPGFHEAIGDTMALSVSTPKHLHKIGLLDKVQNDNET
DINFLMKMALEKIAFLPFGYLIDQWRWSVFSGETPKNRYNQKWWELRCKYQGISPPVDRT
EEDFDPGAKYHIPSNTPYIRYFVSYVIQFQFHKALCEAAGENGPLHQCDIYNSTAAGQKL
GEILQLGSSIPWQDAMERLTGQRKMSASAILEYFKPLIDWLKIKNGNDLATWNTECPEYL
SDGDQQAKMWLNEYNNLAQTKFYEESEVEWTYATNITDENEKKLVTARLELANFEKEAAR
NASQILHHYNMSRITESGRRLFGISNIGTSALKNQTVLQKLNTLQSEIEGIYGKAKFCPE
GNSTCLSLEPDLYRIMSTSRNFTELQTIWKGWRDVSGKKMKEKYAEFVELSNQGIKELDL
GYKDTGDYWRVAYESETFREDLEQLLEKLKPLYQELHTYVRKKLRNLYGDKNFPNSGHIP
AHLLGNMWAQEWQNIYDLLIPFKSKTNVDITPALKSNNYTALRMFRTAEEFFTSLGLKEM
PQTFWDKSMIVKPEGRDVVCHASAWDFYNQRDFRIKMCTDVTMEDLITVHHEMGHIQYYL
QYKDQPLIYRGGANPGFHEAIGDTMALSASTPQHLHKIGLLTNIENDEETDLNYLMKMAL
EKIAFLPFGYLIDQWRWSVFSGETSPDNYNEKWWALRCKYQGISPAVTRTEEDFDPGAKY
HIPSNTPYIRYFVSFVIQFQFHKALCEEAGQTGPLYQCDIYQSKAAGKKLGDMLKLGSSQ
PWQHAMEKLTGQRKMDVGPLIEYFSPLLEWLKVQNQNESGGWMEECPSFLNKVDMETAKQ
WLKKNNEISQIERSKEGEVEWAYATNITDENSKREVEARLELAKYKKRSAKEASYLLRVL
NIPKSTLMGRELYKVSNIGTSALSDKSKLRKLNGLQSDIEGIYAKAQVCVSNDTCLSLEP
DISRIMSSSRNYTELSMIWKGWRDASGKKMKDKYAEFVKLSNEGIQELNMGFNDTGAYWR
SAYETPTFQEDLKQLLEQLKPLYQELHTYVRKQLRKQYGTELFPVSGQIPAHLLGNMWAQ
QWNNIYDLVIPYKNKAKIDITPVLKEKNYTALQMFRTAEEFFKSLGLKPMPETFWNKSMI
VKPEGRDVVCHASAWDFYNQKDFRIKMCTDVTMEDLITIHHEMGHIQYYLQYKDLPVAFR
RGANPGFHEAIGDTMALSVSTPKHLHKIGFLKNLTNDKESDLNFLMKMALEKIAFLPFGY
LIDQWRWSVFSGETPKDRYNQKWWELRCKYQGITSPMPRTEDDFDPGAKYHIPSNTPYIR
YFVSFVIQFQFHKALCEAAGESGPLHQCDIYQSKAAGEKLRNLLKVGSSKPWPEVMKELT
GQSKMDAIAILDYFKPLQQWLEEQNQGEEKGWETNCNSFTHGELFGYWLNNYEDNAKRVF
HDMMKTTFDYESNMTEHNKNKKTEAILKLSEFRKEAYDYVRHIDIPNIKNERHRRQFGKI
KDIGTGALKNVDDLKKMEELQSEMINIYSTAKVSVNGQVQELEPGLTKILTDSSDPNELL
QAWKGFRDAVGRKIRPLYTEYVYLANKAIKELGYKDYGQWERRSFDSETLPADVENILQD
MMPMYRKIHAYAKMKLKSIFGADIFPATGHIPAHLLGNMWAQKWDNIYRLLQPFKNKEII
DVTGALVKQNYTVERMFQTAESFFMSLGMEKMTGKFWKNSMIRKPRDRNVLCHAAAYDMF
DTDDFRIKMCTVKTHESLIVIHHEMGHIQYFMNYENQSVHFRDGANPGFHEAIGDTISLS
VQTPGHLSKIGLLDSNENSEEADLNFLMKMALEKVVFMPFAFIMDNWRWSVYNRDTHPDD
FNSKWWQLRCKYQGISPPVRRTDGDFDPGAKYHIPANYQYISYFMSHVMQFQFHKALCNA
SGHTGPLHTCDIYNSKKAGKLLGDTLKLGSSVPWPDAMEKLTGQRKVDIGPLLEYYKPLM
DWLEKEVKDEDWTDECPHFPEPTPSPHINSGLSLHSSELIVLKGIVLSLILTIFLYL
NT seq 10794 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgcattttttactgattgcatgcatatctgcaactttccattttgcgtccggt
gtaccagtttctgaagaattgataacggacgaggcgaaagccatcgagttcttagaatgg
tacaacaaggaatctactaaagtaacatattcatatttcttaaaacagtgggcatatcaa
acaaacctaacggattttaaccaacaacaagcggtaaacgaagatttagtaaaatcgaag
tttgtcaatgatgccatcaggaacgcttctcggtacaactggcaggtgttttctaatgcg
accgtcaaacggatgttctggaaaattacaaacgtcggtccagcggcgcttagcgatccg
gaaaaagtaaaaaggctaggagccgtgcagagcgagatggagaagatatacagccaagcc
ttagtatgtaacgttaccaacagcagctgtatcgatatggaattcggactaacccccatc
atggccaacagcagggactacgatacgttactgagagcctggaagggttggagggacgaa
acggggaaaaagataaggacccagtatgctgaatacgtccagctcaacaatgaaggcgtg
cgagaggcccctgggggatatgaagatatgggagaatatctgcgtgggtggtatgaatca
cccgatctagagatgcacttggggggacttctgaaacagctgcaacctttgtactcccaa
ctacacgcctatgtcagggccaggctacagaagcattatccccagcatcgcttcccaaag
tcagggcacatacctgctcatatcctgggtaatatgtgggcccaaaactgggaaaacatc
tacggcatcgtgcaaccctttaaagacaaaccggaaatagaagtaactcctgcactcaaa
gcacagcatttcaacgcaacgtcaatattccggactgccgaggatttctttaccagtctt
gagttggatcctttgccggatagtttctgggagaaatcaatgctatctagaccgacggat
ggacgggaggtcatctgccacccctccgcttgggacctaggcaacagcaaagatttcagg
ataaagatgtgtaccgctgttacaatgccagaactgatagtggtccaccatgagctaggg
catgtctggtactacatgatgtacaaggatcaacccttagcattccaggagggtgcaaac
ccagctttccatgaagccattggtgacctgatagctctttcggtgtcaaccccagctcat
ctgaaacaaataggtctactggacacagtcaaaaatgatgaagagagcgacttaaatttc
ttgatggccatggctctccgcaagatcgccttcctgccgtttggttatctgattgaccag
tggaggtggagtgtgtttagtgggaatacgactcaggctgaatacaacaagaattggtgg
gacttgagatgtcgttatcaaggcattcacccccctgtggacagaagcgaggaggatttt
gaccctggagcgaaataccacgtcccctcgggcacaccttacatcaggtattttctaagc
tacataatgcagttccaatttcacaaagctctttgtcaggaaaagaaccacaccgggcca
ttgtatacctgtgatatatacaactcaaaagctgctggggataaactcagatctgcgcta
caactgggctcctccaaaccatggccggaggtgatgaaggttttgacaggttcccctaaa
gtcgatgtagggccgttaatggagtacttctcaccactgatagaatggctgaaggaaacc
aacgaagaagaagggaactcccttggatgggcccctcacggctgtccatctctcagaaca
gggaaagtggaagacgaggaagcggctagaaaattcgcacaggaatttaacgatatggca
gaggatcagtacagcaaggatatagagatcagctgggaatacaacacaaacatcactgat
tacaaccaaaaacgagtggtaaattccagtgtggaaatcgccgagtttaggaaagaaatg
gcggatctggctaacctgtatgactggcacttgttcaaggacgagaaactgaagagattg
ttctctagaatcaccgccattggaaccgcggtacaggatgatacagcaaaacaagcaaag
atgacagaggttcaatcagacatggagtccatctacagcaaggccaacgtctgtctgagc
gacggatcctgccatcagatagaacccggtttaactaagttgttggcgacctcaaagaat
tacagtcttttaagcgaagcttgggttcaatggagagacgctacaggaaagaaaatgaag
tccaaataccaagaactcgtaaaactgagcaatgaggccatccgccttgcagatttcgca
gacattggagcttactggcggaggtggtacgaatctgcgacattccaacaggatctggag
aacttattaaaccagttgcagccattgtatgaaaacttacatgcttacgtccgtaggaaa
cttaaggaagtctacgacagcgatattgacaagtttccaacatccggccacatcccggct
catcttctaggaaatatgtgggcccaagggtggaacaacatagcaaagtatgttttgcct
tatccagacagagaaagcattgatgtctcaccaaaactaaaagaaaagggctacgatgcc
aagaaactgtttaaaatttcggaggagtttttcctgtcgcttggcctgattggcatgcct
gagactttctggaatgatagcatgatcacgaagccagacgacagggaggtggtctgccac
gcctcagcctgggacttctacaacaggaaggactatagaataaaaatgtgtacggagatt
aacatggaggatctgatcaccatccatcatgagatgggacacatcgagtacttcctgcag
tacaaggaacaacctctggtctacagagatggcgccaacccaggatttcatgaggctgtt
ggtgacgtcatggctctttctgtatcaaccccagaacaccttcatgaaattggcttgctg
gacaagttagaaaatgatacagaaaccgacctaaactttctgatgtcgatggctctggag
aaagtcgcctttttgccgtttggatatttgatagaccaatggcgatggagtgtgttcagt
gggaatacttcatacacagactacaataaaaagtggtgggagttaagatgcaagcaccaa
ggaatagctccgccagtggaaagaacttctgacgattttgatcccggtgcaaaatatcat
gttccggcaaatgttccttatataagatactttgtgagttacgtcgttcaattccaattc
caccaagccttgtgtaaagaggccggtcggacagacgttccactacacaggtgtgacatc
tacagatccaaggaggcgggcaagaaactcagtgagatgttgaagttaggctcttcggta
tcttggcaagaagcaatggagaaaataacaggacagagggaaatgagcgccaaggctgtg
ctggagtatttccagcctttaacggactggttaaagaaacaaaatgagggtgaggaaatc
ggatggacaggtgcctgccctggcaatggacgtaagagaactgcagaggttgccaaacaa
tggctgaaggaatacaatacgatagcggaacaagcgctgtacactatcagtgaagtagag
tggagctatgccaccaacattacggacgagaactccaggaaacttgttgacgccagatta
gtatatgctaagtttaataaagaagctgctcagaatgcgtctcaacttctgagggaatta
gatactagtttaagtccgacggaaagaagagaattgaagaaaatttctacaataggaacc
gatgccctgaagaacgaaaccaaacttaaacagttgaattcactacaatcagaaatagag
ggactgtatggtaaagccaaggtctgcgttggacacggaaaatgtctacctctagaacca
gatgtgtacaaaattatggcaacttcacggaattacagtgaattagaaatggtttggaaa
ggctggagagataacagcggaagacgaatgaaggacaaatatgctaagtttgttgatctt
agtaaccaggccattcaagatctaaaccaagggttcaaagacactggcgattattggcga
tcggcgtacgagagtgccacattccaggaagacctggaaaaccttttgacggagttgaaa
ccactgtatgctcagctccatacttacgtcagaaatcagcttcgatcattgtatggcgcg
gataagttccctagatctggtcacatcccagcccatctccttggcaatatgtgggctcaa
cattgggacaacatctacgacattgtgattccattcaaagataaaacaaatgttgacgtc
acacccacaatgttagcacagaattacactgccctccgcatgttccgaacgtctgaggag
ttcttcaagtctcttggattaaaggaaatgcctcaacctttctgggacaagtcaatgata
gtcaaaccaccaggccgagaggttgtttgtcatgcatctgcctgggacttctataatcgg
aaagattttagaatcaaaatgtgcacggacatcacaatggaaaacctgatcaccattcat
catgagatgggccacattcagtattatctacaatatcaagacaagcctgtggaattcagg
gagggggccaacccaggtttccatgaagctattggtgacacaatggcgctatcagtgtca
acaccaaaacatcttcataagattggcctattggataaggtccaaaatgataatgaaact
gacataaatttcttgatgaaaatggcgctggagaagatcgccttccttccatttggttat
ctgattgaccagtggagatggagcgtgttcagtggggagacacccaaaaacagatacaac
cagaagtggtgggaactcagatgtaaatatcaaggtatatcaccaccagtagatagaact
gaggaagattttgatcccggtgcaaaataccacattccatctaatacgccttatatcagg
tacttcgtaagttacgtgatacagttccagttccacaaagctctatgtgaggcagctgga
gaaaatggacccctacatcagtgtgacatctataattcaacagccgcgggacagaaactt
ggagagatattacaacttggctcgtctataccatggcaggatgcaatggaacggttaaca
ggacagaggaaaatgagcgccagcgccattttggaatatttcaaacctcttattgattgg
ttaaaaatcaaaaatggaaacgatttggctacttggaacaccgaatgtccagaatattta
tcagatggcgatcaacaagcaaaaatgtggttgaatgagtataacaatttagcccagacc
aagttttacgaggaatcagaggtagaatggacgtatgcaaccaatattacagacgaaaac
gagaaaaaactggtcacagcaagattggagctggctaattttgagaaagaggcagctcga
aatgcatcacaaattttacaccattataacatgtccaggatcactgagagtggtcgacgg
ttgtttggaatttctaatattggtacaagcgcactcaagaatcaaacggtgctccaaaaa
ttaaacacgcttcaatctgaaatagagggcatatatggtaaagcaaaattctgtcctgaa
ggaaactctacatgtctttctttggaacctgacttgtacagaataatgtcgacctcgagg
aactttacggagcttcaaacaatctggaaaggatggagggacgtcagtggcaagaagatg
aaagaaaagtatgccgagtttgtagaactgagtaaccaaggaattaaggagcttgattta
gggtataaagatacaggggattattggagagttgcgtatgaaagtgaaactttcagggag
gatcttgaacaacttctggaaaaactcaaaccactatatcaggaacttcacacatacgta
cggaagaagctacgaaacttgtatggagataaaaactttccaaactcgggacatattccg
gctcacctattgggaaatatgtgggctcaggagtggcaaaacatatatgaccttctgatt
ccattcaaaagcaaaacgaacgttgatattacacctgcattgaaatccaacaattacacg
gccctccgcatgtttcgaacggccgaggagttctttacgtctcttggattaaaggaaatg
ccccagacattctgggacaagtctatgatagtcaaaccagaaggcagggacgttgtttgt
catgcctccgcctgggacttctataaccaaagggattttagaatcaagatgtgcactgac
gtcacaatggaggacctgattacagttcatcatgaaatgggtcacattcagtactaccta
cagtataaagaccagcctcttatctacaggggtggtgccaatccaggattccacgaggct
atcggggatactatggctttgtcggcatcaacccctcaacatttacataaaataggacta
ttaactaatattgaaaatgacgaagagacagacctgaattacttaatgaagatggcgcta
gaaaagatcgccttccttccatttggttatctgattgaccaatggagatggagtgtgttt
agtggagaaacatcaccagataactataacgagaaatggtgggcattaagatgcaaatac
caaggaatttctccggcagtcacaagaacagaggaggacttcgatcccggtgcaaaatat
cacattccttctaacacaccatatatcaggtactttgtaagtttcgtgatacagttccag
ttccacaaagctctgtgtgaggaggcaggtcaaacaggcccactataccagtgtgacatc
taccaatcaaaagcggcaggcaaaaaactcggagatatgctaaagctagggtcctcgcaa
ccttggcaacatgcgatggagaagttgacagggcaacggaaaatggacgttgggccgttg
atagagtacttcagtccattgttggagtggcttaaagtccagaatcaaaacgaatcaggt
ggatggatggaggagtgtccaagcttcttgaacaaagtggatatggagactgccaagcag
tggctgaaaaagaataacgagatatcgcaaatagagcgaagcaaagagggagaggtggaa
tgggcatacgctacaaatattactgatgaaaattccaaaagagaggtagaagcacgactg
gaacttgctaaatataagaaacggtcagctaaagaagcatcataccttttgcgtgttcta
aacattccaaaatccactttgatggggcgtgagttgtacaaggtgtcaaatattggaaca
agtgccctttccgataagtcaaagttaagaaagctgaacggcctgcagtctgatattgaa
ggaatatacgcaaaagcacaagtttgcgtatcaaacgatacctgtttatcgctagagcca
gatatctctagaatcatgtcttcctcgagaaattataccgagttatcaatgatttggaaa
ggatggagagatgctagtggaaagaaaatgaaagacaaatatgctgaatttgtgaaactg
agtaatgaaggaattcaggaacttaatatgggttttaacgataccggcgcatactggaga
tccgcgtacgaaaccccaactttccaagaagatctaaaacaactgctagaacagttaaaa
ccattatatcaagagctccatacatacgttcggaagcaattaagaaagcaatacggcaca
gagctgttccctgtctcaggccaaattcctgctcatttacttggaaacatgtgggcacaa
caatggaataatatttatgatttggtgataccatataaaaacaaggcgaagatagatata
actcctgttcttaaggaaaaaaattatactgcactgcaaatgttcaggactgcagaggaa
tttttcaagtcacttggtttaaaacctatgcctgaaacattttggaacaagtctatgata
gttaaaccagaaggacgggatgttgtttgtcatgcgtccgcatgggatttctataaccaa
aaggactttagaataaaaatgtgcactgacgtcactatggaggatttgattactattcac
catgaaatgggacacattcagtactatcttcaatacaaagacttgcctgtcgcctttaga
aggggggctaatccaggattccacgaagcaattggtgataccatggctctatctgtgtcg
acgccaaaacatttacataagattggatttctgaaaaatctcacaaacgataaagaatca
gacttaaatttcttgatgaaaatggcgctggagaagattgccttccttccgttcggttat
ctgattgaccagtggagatggagcgtgttcagtggggagacacccaaagacagatacaac
cagaagtggtgggaactcaggtgtaaataccaagggataacttccccaatgcccagaaca
gaagatgattttgatccaggagctaaataccacattccatccaacacaccatatataagg
tactttgtgagtttcgtgatacagttccaattccacaaagctttgtgtgaggcggcagga
gaaagcggacccctacatcagtgtgacatctaccagtcaaaggcagctggagaaaaactg
agaaatttgcttaaagttggttcttctaaaccctggccagaggtaatgaaggaattaaca
ggccagtccaaaatggatgcgatagcaatattggactatttcaagcctctgcagcaatgg
ttagaagagcaaaaccaaggagaagaaaaggggtgggaaaccaattgcaatagttttacc
catggagaactgttcggttactggttgaataattatgaagacaatgcaaagcgtgttttc
catgatatgatgaaaacaacgtttgattatgaatcaaatatgactgaacacaacaaaaac
aaaaagacagaggccatacttaaattgtcggaatttaggaaagaagcatacgactacgtc
agacacattgatattccaaacattaagaacgagcgccaccgccggcagtttggaaagata
aaagatatagggaccggggctctgaaaaacgttgatgatttgaaaaagatggaggaacta
cagtcagaaatgataaatatatacagtactgcgaaggtgtcagttaatggacaagtacag
gaacttgaaccaggattaacaaagatcctgaccgattcctctgatcccaacgaacttctc
caagcatggaagggtttcagagacgccgttggtcgcaaaattaggccgttgtatactgaa
tatgtctaccttgcaaataaagcaatcaaagagcttggttataaagactatggtcagtgg
gaaagacgctcatttgactccgagaccttaccagcagatgttgaaaacattcttcaagat
atgatgccgatgtaccgaaaaatacatgcctatgcgaaaatgaaactcaagagtatcttt
ggtgctgacatctttccggcaactgggcatattccagctcatttgctcggtaatatgtgg
gcccagaagtgggacaatatttaccgactgcttcagccttttaaaaataaagaaataatt
gatgttaccggagctttggtcaaacagaattacactgtagaaagaatgtttcaaacggca
gagagcttctttatgtctcttggaatggaaaaaatgacgggaaagttctggaaaaactcc
atgattaggaagcccagggacaggaacgtcctctgtcacgccgccgcttatgacatgttt
gacacagacgacttcaggataaagatgtgtacggtgaagactcacgagagccttatcgtg
attcaccacgagatgggtcacattcagtacttcatgaactatgagaatcaatccgtgcat
ttcagagacggtgctaacccaggtttccacgaggcgattggtgacactatatcgttgtcc
gttcagacacccggccatctcagcaagatagggcttctggatagtaatgaaaacagcgaa
gaagcagatttgaatttcttgatgaagatggcactagagaaggttgtttttatgccgttt
gcctttataatggacaattggaggtggagtgtatataatcgagacactcatccggatgat
ttcaacagtaaatggtggcaactaaggtgtaaatatcagggaatctctccgccagtccga
agaacagatggcgactttgatccaggggcaaaatatcacattccagctaattatcagtac
atttcgtattttatgagtcatgtcatgcagttccaattccataaagccctctgcaatgcc
tccggtcatacgggtcctctgcatacgtgtgatatttataattctaagaaagctggaaag
ttactcggtgatacactaaaactaggttcatccgttccttggccagacgcaatggagaaa
ctgactggtcagcgtaaggttgatattggtccccttctggagtattataaaccgctgatg
gattggctagaaaaagaggtcaaggacgaagactggacggatgagtgcccacattttcca
gaaccaacaccgtcgcctcatataaacagtggcttgtctctgcattcatccgaactaatt
gttttgaaaggaatagtgttgtctttaatattaacaatatttttgtatctttga

DBGET integrated database retrieval system