Crassostrea gigas (Pacific oyster): 117689131 Help Entry 117689131         CDS       T03920                                  Name (RefSeq) rho-related protein racD-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism crg  Crassostrea gigas (Pacific oyster) Pathway crg04145   Phagosome crg04148   Efferocytosis crg04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:crg00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     117689131  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     117689131    04148 Efferocytosis     117689131  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:crg04131]     117689131   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:crg04147]     117689131    04031 GTP-binding proteins [BR:crg04031]     117689131 Membrane trafficking [BR:crg04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     117689131  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     117689131   Macropinocytosis    Ras GTPases     117689131  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     117689131 Exosome [BR:crg04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    117689131   Exosomal proteins of other body fluids (saliva and urine)    117689131   Exosomal proteins of colorectal cancer cells    117689131   Exosomal proteins of bladder cancer cells    117689131 GTP-binding proteins [BR:crg04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     117689131 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 DUF1366 Motif Other DBs NCBI-GeneID:  117689131 NCBI-ProteinID:  XP_034324904 LinkDB All DBs Position LG3:25611771..25612635 Genome browser AA seq 183 aa AA seqDB search MVGKTTLLKSYVTCKPPEIYSPTIYDNIKGSVVLGKKKYKVNLVDTAGQHEYSNLCTATY KKSRVIILCYSVIDRQSFDRIKTFWIPELRKNLGKRVPIVLTATHTDLRNDKYIKRCIEV VSSSEGKQLADSFGAKGFYEISRSNISQTNDIFECAVKAVVGEKRTLFTIFKKVFCNTRR NKN NT seq 552 nt NT seq  +upstreamnt  +downstreamnt atggttggaaaaactacccttttgaaatcttatgtcacgtgcaaaccgccagaaatctat tcgccaacaatttacgacaatatcaaaggatctgtcgttcttggcaagaaaaagtacaaa gtcaacctcgtggatactgcaggccagcacgagtactccaatctttgtaccgcgacttac aaaaaaagccgagtgatcatcttatgctacagtgtgatagacagacaatcgttcgaccga attaaaaccttctggattcccgaactccgaaagaatctgggaaaacgcgtacccatagtt cttacagccacgcatacagacctccgaaatgacaaatatatcaagagatgcatagaagtg gtgtcgtccagcgaggggaaacagttggcggacagttttggggcaaagggtttttatgaa atttccagatccaacatttctcaaactaatgacatttttgaatgtgccgtcaaggctgta gttggcgagaagaggacattgtttactatttttaaaaaagtattttgtaatacccgaaga aataaaaactga

DBGET integrated database retrieval system