KEGG   Carnobacterium sp. 17-4: CAR_c00170Help
Entry
CAR_c00170        CDS       T01452                                 

Definition
(GenBank) alpha amylase catalytic region
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CAR_c00170
Enzymes [BR:crn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CAR_c00170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
17834..19294
Genome map
AA seq 486 aa AA seqDB search
MYKNGLMMQYFEWYVENDGKHWKRLKEDAKHLHEIGVTSVWIPPCFKGMDKNDNGYGIYD
LYDLGEFDQKGTVRTKYGTKEELIAAIEELHKYEIQVYADIVLNHKAGADGTERFKAVEV
NPDDRNQKISEAYEIEGWTEFTFPGRKGKYSDFHWHWYHFSGTDYNQENEKKAIYRIEGQ
HKGWADDETVDNEYGNYDYLMFADIDYSHPEVVEETKKWANWFIEETGVDGFRLDAVKHI
NEKFIYELRESIEANFGRQFFIVGEYWDQNYTNLNSYLDSQDYKLDLFDVGLHHQLEKAS
KMGQNFDLTHLFDQTLIKNNPMQAVTFVDNHDSQPNQSLESFVEPWFKPIAYGVILLRKE
GYPVLFYGDYYGIKGENPIEPHREVIDKLLYVKKHYAYGEQTDYFDHHNCIGWTRSGNEE
YPIGCSIVISNSDAGYKDMFVGKEKVGFVYEDYLGNCAETVTIDEEGNGHFLVEAGSISV
WVNRKE
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtataaaaatggactgatgatgcagtatttcgaatggtacgtagaaaatgatgggaaa
cattggaaacggttaaaagaagatgcaaaacacctacatgaaataggtgtaacaagtgta
tggatcccaccttgctttaaaggtatggataaaaatgataacggatatggtatttatgat
ttgtatgatttaggggaatttgatcaaaaaggcactgtacgtactaaatatggcaccaag
gaagaactaattgcagctattgaagaattacataaatacgagatacaagtctatgcagat
atcgttttaaatcataaagcaggtgcagatggaactgaacgatttaaagcagttgaagtg
aacccggatgatcgtaatcaaaagattagtgaagcttatgaaattgaaggatggacagag
tttacgttcccaggcagaaaaggaaagtattctgattttcactggcactggtatcatttt
tctggaacagattacaatcaagaaaatgaaaaaaaagctatttaccgtattgaaggtcaa
cataaaggttgggcagatgatgagacggtagataatgaatacggaaactacgattacttg
atgtttgctgatattgattatagtcatcctgaagtcgttgaagaaacaaaaaaatgggct
aactggtttattgaagaaactggagtggatggatttaggttagatgctgttaaacatata
aatgagaaatttatttatgaacttcgtgaaagtatagaagctaactttggcagacagttt
tttatagtaggagaatattgggaccaaaattatacaaatttgaatagttatttagatagt
caagattacaagttggatttatttgatgtaggattacaccatcaattagaaaaagcttcg
aaaatgggtcaaaactttgatttaacacatttatttgatcaaacattaattaaaaacaat
ccaatgcaagctgtaacatttgtagacaatcatgattcacagccaaatcaatcacttgaa
tcatttgttgaaccttggtttaaacctatagcttatggagtcatcttattaaggaaagaa
ggatatcctgtactcttttatggtgattactatggtataaagggagaaaatcctattgag
ccgcatcgtgaagtgattgataaattactttatgtaaaaaaacactatgcatatggagag
caaacggattattttgaccatcataattgcattggttggacgcgttcaggaaatgaagag
taccccataggatgttctatagtcatttcaaatagtgatgctggttataaagatatgttt
gtaggaaaagaaaaagtgggatttgtttatgaagattatttaggcaattgtgcggagaca
gtaactattgatgaagaaggaaatggtcattttcttgtagaagctggatccatatctgta
tgggttaatagaaaagaataa

DBGET integrated database retrieval system