KEGG   Carnobacterium sp. 17-4: CAR_c17080Help
Entry
CAR_c17080        CDS       T01452                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
crn  Carnobacterium sp. 17-4
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CAR_c17080 (tdk)
Enzymes [BR:crn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     CAR_c17080 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1777008..1777589)
Genome map
AA seq 193 aa AA seqDB search
MAQLFFKYGAMNSGKTIEILKVAYNYEEQNKPVAIMTSGLDDRDEIGVVSSRIGLRREGI
AIFEETNVFETINALNYVPACVLIDESQFLKKEHVLQLAHIVDELDIPVMAFGLKNDFKN
ELFEGSEYLLLYADKIEEMKTICWYCHKKATMNMRMIDGKPVYAGAQIQIGGNESYFPVC
RKHYFNPLLKDDL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcccaacttttttttaaatatggagcaatgaatagtggaaagactattgaaatttta
aaagtagcatataattatgaagaacaaaacaaacctgtcgcaattatgacaagcggtttg
gatgatcgtgatgagattggtgtagtatccagtcgaattggcttaagacgtgaaggaatc
gcgatatttgaagaaacaaacgtttttgaaacgataaatgcattgaattatgtaccggca
tgtgtactaattgatgaatcgcaatttttgaaaaaggaacatgttcttcagttggctcat
attgtggatgaattagatattcccgttatggcatttggattgaaaaacgactttaaaaat
gaactgtttgaaggttcagagtacttattgctatacgcggataaaattgaagaaatgaaa
actatttgttggtattgccataaaaaagcaacgatgaacatgcgtatgattgacggaaag
ccagtttatgcaggagcacaaattcaaatagggggcaatgaaagttatttcccagtttgt
cgcaaacattacttcaatccgctattgaaggacgacttgtag

DBGET integrated database retrieval system