KEGG   Citrobacter rodentium: ROD_43631Help
Entry
ROD_43631         CDS       T01145                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
cro  Citrobacter rodentium
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ROD_43631 (puuE)
   00650 Butanoate metabolism
    ROD_43631 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ROD_43631 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ROD_43631 (puuE)
Enzymes [BR:cro01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ROD_43631 (puuE)
Amino acid related enzymes [BR:cro01007]
 Aminotransferase (transaminase)
  Class III
   ROD_43631 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4609654..4610919
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCDYFVEKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
IVAAVEQQLQAFTHTAYQIVPYESYVSLAERINAIAPIDGPAKTAFFTTGAEAVENAVKI
ARASTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAVYPNAAHGVTVE
EALNSLERIFKADIAADQVAAIVLEPIQGEGGFNVAPAAFMQALRKICDTHGILLIADEV
QTGFARTGKVFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDIIEEEQLCQRANQLGEHLKEVLNQAREHCPAIADVRGLGSMVAVEFND
PQTGKPSADFTRQIQRKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILTRVLR
G
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagttcagaactgaatcagcgtcgtcagcaggcgactccccgtggtgtaggtgtg
atgtgcgactactttgtggagaaagccgagaacgccacgctgtgggatgtggaaggtaat
gaagtgatcgattttgccgccgggatcgcggtgctgaataccggccatcgccatccgaag
attgtggccgcggtagaacaacagctgcaggcgtttacccacactgcgtaccagattgtt
ccatacgagagctacgtttcgctggcggagcgcatcaacgccatcgcgccgattgacggt
ccggcaaaaaccgccttcttcaccaccggtgcggaagcggtagaaaacgcggtgaagatc
gcccgcgccagcaccggccgtcccggtttaatcaccttcggcggcggctttcatggccgt
acctttatgacgatggcgctgaccggcaaagtggcgccttacaaaataggctttggcccg
ttccctggttcggtttaccacgccgtatacccgaacgcggcccacggcgtgaccgttgag
gaggcgctcaacagcctggaacgcatcttcaaagccgatatcgccgccgatcaggtagca
gcgattgtgctggagccgattcagggcgagggcggttttaacgtcgcacctgccgccttt
atgcaggcgctgcgcaagatttgcgatacccacggcattctgctgatcgccgatgaagta
cagaccggcttcgcccgcaccgggaaagtcttcgcaatgcagcattacgacgtgaagcct
gacctgatgacgatggcgaaaagcctggcgggcggcttcccgctctccggcgtggtcggg
cgggcggaggtcatggatgcccctgcgccgggtggtctgggcggcacctacgccggtaat
ccgctggcggttgccgccgcgcatgcggtgctggatatcatcgaagaagaacagctgtgc
cagcgggcgaaccagctgggcgaacacctgaaagaagtgctgaatcaggcgcgcgaacac
tgcccggcgattgctgacgtccgcgggctgggatcgatggtggcggtggaatttaacgat
ccgcaaaccgggaaaccgtccgctgactttacccgccagatccagcgtaaagcgcaggaa
aacggtctgctgctgttgagctgcggcgtgtatggcaacgttattcgtttcctctacccg
ttaacgatcccggatgcgcagttcagcaaagcgctggatattctgacccgcgtgctgcgg
ggctga

DBGET integrated database retrieval system