KEGG   Chlorocebus sabaeus (green monkey): 103243232Help
Entry
103243232         CDS       T04361                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
csab  Chlorocebus sabaeus (green monkey)
Pathway
Renin-angiotensin system
Renin secretion
Chagas disease (American trypanosomiasis)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:csab00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    103243232
   04614 Renin-angiotensin system
    103243232
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    103243232
  Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    103243232
Enzymes [BR:csab01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103243232
Peptidases [BR:csab01002]
 Metallo Peptidases
  Family M2
   103243232
Exosome [BR:csab04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103243232
CD molecules [BR:csab04090]
 Proteins
  103243232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
16
AA seq 1307 aa AA seqDB search
MGAASGRRGPGPLLQPLLLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQ
VLFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPELRK
IIGAVGTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASS
RSYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDD
LEHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVP
FPDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVC
HASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRGGANPGFHEA
IGDVLALSVSTPAHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVF
NGRTPPSHYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQ
FHEALCKEAGYEGPLHQCDIYQSTKAGAKLRKVLQAGSSRPWQEVLKDMVGSDALDAQPL
LNYFQPVTQWLQEQNQQNGEVLGWPEYQWRPPLPDNYPEGIDLVTDEAEASKFVEEYDRT
SQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARRFDVNHFQNTTIKR
IIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHTNGSCLQLEPDLTNVMATSRK
YEELLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLE
RLFQELQPLYLNLHAYVRRALHHHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFP
SAPSMDPTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHA
SAWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIG
DVLALSVSTPKHLHSLNLLSSEGGSHEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDG
SITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFISFIIQFQFH
EALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLS
YFKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQ
WLLLFLGIALLVATLGLSQRLFSIRHQSLHRHPQGPQFGSEVELRHS
NT seq 3924 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggccgctgctgcagccgctgctactgctg
ctgctgctaccgccgcagcccgcgctggccctggaccccgggctgcagcccggcaacttt
tccgccgacgaggccggggcgcaactcttcgcgcagagctacaattcgagcgccgaacag
gtgctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgccgagaat
gcacggcgccaggaggaagcagccctgctcagccaggagtttgccgaggcctggggccag
aaggccaaggagctgtatgaaccgatctggcagaacttcacggacccggagctgcgcaag
atcattggagctgtgggcaccctcggctctgccaacctgcccctggctaagcggcagcag
tacaatgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctcccc
aacaagactgccacctgctggtccctggacccagacctcaccaacatcctggcttcctcg
cgaagctacgccatgctcctgtttgcctgggagggctggcacaacgccgcgggcatcccg
ctgaaaccgctgtacgaggacttcactgccctcagcaatgaagcctacaagcaggacggc
ttcacagacacgggggcctactggcgctcctggtacaactcccccacttttgaggacgat
ctggagcacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgc
cgtgcactgcatcgccgatatggggacagatacatcaacctcaggggacccatccctgct
catctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtagtgcct
ttcccagacaagcccaacctcgacgtcaccagtactatgctgcagcagggctggaatgcc
acgcacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcct
cccgagttctgggaagggtcgatgctggagaagccggccgacgggcgggaggtggtgtgc
cacgcctcggcttgggacttctacaacaggaaagacttcaggatcaagcaatgcacacgg
gtcacgatggaccagctctctacagtgcaccacgagatgggccatatacagtactacctg
cagtacaaggacctgcccgtctccctgcgtgggggggccaaccccggcttccatgaggcc
attggggacgtgctggcactctcggtctctactcctgcacatctgcacaaaatcggcctg
ctggaccgtgtcaccaatgacacggaaagtgacatcaattacttgctaaagatggcactg
gaaaaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtcttt
aatgggcgtactcctccttcccactacaacttcgactggtggtatcttcgaaccaagtat
caggggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagttt
catgttccaaatgtgacaccatacatcaggtactttgtgagtttcgtcctgcagttccag
ttccatgaagccctgtgcaaggaggcaggctatgagggcccactgcaccaatgtgacatc
taccagtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccagg
ccctggcaggaggtgctgaaggacatggtcggctcagacgccctggacgcccagccactg
ctcaactacttccagccggtcacccagtggctgcaggagcagaaccagcagaatggcgag
gtcctgggctggcctgagtaccagtggcgcccaccgttgcctgacaactacccggagggc
atcgacctggtgaccgatgaggctgaggccagcaagttcgtggaggaatatgaccggaca
tcccaggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacattacc
acagagaccagcaagattctgctgcagaagaacatgcaaatagccaaccatactctgaag
tacggcacccaggccaggaggtttgatgtgaaccacttccagaacaccacgatcaagcgg
atcataaagaaggttcaggacctagaacgggcagcgctgcctgcccaggagctggaggag
tacaacaagatcctgttggacatggaaaccacctacagcgtggccactgtgtgccacacg
aatggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacatcccggaaa
tatgaagaactgttgtgggcatgggagggctggcgagacaaggctgggagagccatcctc
cagttttacccaaaatacgtggaactgatcaaccaggctgcccggctcaatggctatgta
gatgccggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggag
cgcctcttccaggagctgcagccgctgtacctgaacctgcatgcctacgtgcgccgggcc
ctgcaccaccactacggggcccagcacatcaatctggaggggcccatccctgctcacctg
ctggggaacatgtgggcgcaaacctggtccaacatctatgacttggtggtgcccttccct
tcagccccctcgatggaccccacggaggccatgctaaagcagggctggacgccccggagg
atgtttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgag
ttctggaacaagtcgatgctggagaagccaactgatgggcgagaggtggtctgccacgcc
tcggcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaac
ttggaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtac
aaagacttgcctgtggccttgagggaaggtgccaaccccggcttccatgaggccattggg
gacgtgctagccctctcagtgtctacgcccaagcacctgcacagtctgaacctgctgagc
agtgagggtggcagccacgagcacgatatcaactttctgatgaagatggcgcttgacaag
atcgcctttatccccttcagctatctcgttgatcagtggcgctggagggtgtttgatgga
agcatcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggc
ctctgccccccggtgcccaggactcaaggtgactttgacccaggggccaagttccacatt
ccttctagcgtgccttacatcaggtacttcatcagcttcatcatccagttccagttccat
gaagcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccag
tccaaggaggcagggcagcgcctggcgacggccatgaagctgggcttcagtaggccgtgg
ccagaagccatgcagctgatcacgggccagcccaatatgagcgcctcggccatgctgagc
tacttcaagccgctgctggactggctccgcacggagaatgagctgcacggggagaagctg
ggctggccgcagtacaactggacaccgaactccgctcgctcagaagggcccctcccagac
agcggccgcgtcagcttcctgggcctggacctggatgcgcagcaggcccgcgtgggccag
tggctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcgg
ctcttcagcatccgccaccaaagcctccaccggcacccccaggggccccagttcggctct
gaggtggagctgagacactcctga

DBGET integrated database retrieval system