KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_1550Help
Entry
Clst_1550         CDS       T02527                                 

Gene name
ligD2
Definition
(GenBank) LigD
  KO
K01971  
bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:csd00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Clst_1550 (ligD2)
Enzymes [BR:csd01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Clst_1550 (ligD2)
DNA repair and recombination proteins [BR:csd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Clst_1550 (ligD2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1732804..1733715)
Genome map
AA seq 303 aa AA seqDB search
MDWFEPMEPILTNTIMKGDQWIHQVKWDGIRCLAYKDGNNVRLFTKRGRERSRWYPEITK
EILDLNCKQVVLDGELIVPDEYGKPSFHNIMARDRVSRIDRLRQYIEKYPVWYMVFDILC
KEGQDLRVLPLLERKRMLDETLKSNGNVQAVSDYSDGEALFSIMKEKDMEGIVSKKADSP
YIGGKKHKMWFKTKIIKQMTATVCGVKVKDYRVKSLVIAENRDGKLVPVGNVSSGLSDKD
KITLFNVLPQLAADAAGLYGNVKSDDVIWVKPVLKVIVSFIEREENGSLRHPVLVGFTDE
KTE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggattggttcgagccgatggagcccatacttacaaatactataatgaagggagaccaa
tggattcaccaggtaaaatgggacggaataagatgtctggcatataaagacggcaataat
gtcaggctgtttaccaaacgaggccgtgaacgttcccggtggtaccctgaaataacaaag
gaaattttagatctgaattgcaaacaggtggtactggacggcgaactgatagtaccggac
gagtacggaaaaccttcatttcataatattatggcaagggacagagttagtagaattgat
aggctcagacagtacatcgaaaaatatcctgtatggtatatggtttttgacatactgtgt
aaagaaggtcaggatttaagggtgcttccgctgcttgaaagaaaaagaatgcttgatgaa
acgttaaaaagcaatggcaatgttcaggctgtttccgattattccgatggagaagctctg
ttttcaataatgaaggaaaaggacatggagggcattgtatcaaaaaaagccgacagccct
tatatcggcgggaaaaaacataaaatgtggtttaaaacgaaaataataaagcaaatgacc
gcaacggtgtgcggggtcaaagtaaaggattacagggttaaatcccttgttattgcggaa
aaccgtgacgggaaacttgtgcctgtcggaaacgtatcgtcgggcttatccgataaagac
aaaataacccttttcaatgttcttccacagcttgccgcagatgcggcaggtttgtacgga
aacgtaaaaagcgatgatgtgatttgggtaaaaccggttcttaaagttattgtctcattt
atcgagcgggaagaaaacggaagcttgagacatccggttttggtgggttttaccgatgag
aagacggagtag

DBGET integrated database retrieval system