KEGG   Cynoglossus semilaevis (tongue sole): 103379132Help
Entry
103379132         CDS       T04866                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csem00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103379132 (hk1)
   00051 Fructose and mannose metabolism
    103379132 (hk1)
   00052 Galactose metabolism
    103379132 (hk1)
   00500 Starch and sucrose metabolism
    103379132 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    103379132 (hk1)
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103379132 (hk1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    103379132 (hk1)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103379132 (hk1)
Membrane trafficking [BR:csem04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103379132 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
5
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDITQRFRMELANGLGRDTNPTAV
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYNTPEDIIH
GTGTRLFDHVAECLGDFIEKHDIKEKKLPVGFTFSFPCQQTKLDESYLITWTKRFKASGV
EGMNVVELLNKAIKKKGTYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAREGMLFEGRITPELLTRGTFETKHISAIEKNKEGLCKAKEILTKLG
VEPSDEDCIAVQHVCAIVSFRSANLIAAVLAGILKRLKENKGVSRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSSKGAAMVTAVAYRLANQSQEIKEMLSEFRLT
NDQLLEVKNRMTSEMQKGLSKSTQESATMKMLPTFVCSTPDGTEYGDFLALDLGGTNFRV
LLVKIRSGKKKSVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNARLPLGF
TFSFPCKQTSLDAGILLTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCQIGLIAGTGSNACYMEDMRNIEMIEEDKGQMCINMEWGAFGDNGCLDD
IRTEYDRNVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCEAVSRRAAQLCGAGMAA
VADKIRKNRGKDHLEIIVGVDGTLYKLHPHFSRIMHQTVKELAPQCDVNFLLSEDGSGKG
AALITAVGCRLRQELNNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccagctattggcttattacttcactgaactcaaggatgaccaggtcaag
aagattgataagtacctctactccatgcgtttctctgatgagactttactggacatcaca
cagcggtttcgcatggagctggccaacggactgggccgggacacaaaccccacagctgta
ctgaagatgctgcccacatttgtgcgatcgatccccgatggctcagagaaaggcgacttc
atcgctctggacctgggcggcagtaacttcaggattcttcgtgtgaaagtgagccatgag
aagaaacaaaccgttcagatggagagtcaaatctacaacacaccagaggacatcatccac
ggaactggaaccagactgtttgaccatgtggccgaatgcctgggtgacttcatagaaaag
cacgacattaaagagaagaaacttccagtagggttcaccttctctttcccctgtcagcag
accaaactggacgagagctatctaataacatggacaaagcgcttcaaggctagtggagtt
gaaggaatgaacgtcgtggagctactgaacaaagccatcaagaaaaaagggacttatgaa
gctgacatcatggctgtagtcaatgatacagttgggacaatgatgacctgtggttttgac
gaccaacgctgtgaagttggaatcatcattggcacaggcaccaacgcctgctacatggag
gagctgcgtcacattgacctggtggaaggagacgagggcaggatgtgtgtgaacacggag
tggggagcatttggagacgacggccggctggaagacatcaggacagagttcgacagagaa
atagacagaggttctctcaaccccgggaaacagctatttgagaagatggtgagtgggatg
tacctgggggagctggtccgtctcatactggtgaagatggccagagagggaatgctgttt
gaaggaaggatcaccccggagcttctgaccagagggacgtttgaaaccaaacacatctca
gccattgaaaagaataaggagggactgtgcaaagccaaagagattttaaccaaactgggt
gtggagccctctgatgaggactgtattgctgtgcagcacgtgtgtgccattgtgtccttc
cgctctgctaaccttatagctgctgtgctagctggtattctgaagagactgaaggaaaac
aaaggtgtttcccgactacgcaccactgtaggcattgacggctctctctacaaaatgcac
ccgcaatatgcccgtcgccttcacaagacggtccgtcgtttggtcccggactctgacgtg
cgtttcctcctgtcagagagcggcagcagtaaaggagcggccatggtcacggctgtagcc
tacagactggccaaccagtcacaggaaatcaaagaaatgctgtcggagtttcgattgacc
aatgaccagctgctggaggtgaaaaatcgaatgacaagtgaaatgcaaaaaggcctttca
aagagcactcaggaatctgctaccatgaagatgttgccaaccttcgtctgcagcactcct
gacggcacagagtacggtgatttcctggccttggatttagggggaacaaacttcagagtt
ctgttggtcaagatccgttcgggcaagaagaaatccgtggagatgcacaacaagatttat
gccattcctctggaagtgatgcagggcacaggagaggagctgtttgatcacattgtacag
tgcatcagtgacttcctggactacatgggtatgaagaacgctcgtctgcctctgggcttc
accttctccttcccctgcaaacagaccagcctggatgctggcatcctactgacgtggacc
aaaggcttcaaggccacagactgtgaaggagaggatgtggtgggactgttgagagaagcc
atcaagaggagagaggagtttgacctggatgtggtggccgtcgtcaacgacaccgtggga
accatgatgacctgcgcctacgaagaacctacctgtcagattggactcatcgctggcact
ggcagtaacgcctgttacatggaggacatgaggaacatcgagatgatcgaggaagacaag
ggacagatgtgcatcaacatggagtggggagccttcggagacaacggatgtctggacgac
atcaggacggaatatgatcgcaatgtggacgacttctctctcaatccaggcaaacaaagg
tatgagaagatgtgcagtggcatgtacctgggagaaatcgtgcgaaacatcctcatagac
atgaccaagagaggattcctgttccgagggcagatctctgagaccctgaagaccagaggc
atctttgagacaaagtttctgtcccagatagagagtgacagactggctctgctgcaggtc
agatccatcctgcaacacctaggactggacagcacgtgtgatgacagtatcatagtcaaa
gaggtgtgcgaggcagtgtcacgtcgagcagctcagctgtgcggggcaggaatggcagcg
gtggccgataaaatccggaagaaccgtggaaaggaccatctggagatcattgttggtgtg
gatggaactctgtacaagcttcatccacacttttcccggattatgcaccagacggtgaag
gaactggctcctcagtgtgacgtgaacttcctgctgtcagaggacggcagcggtaaagga
gctgccctcatcacagctgtgggctgcagactgagacaggagctgaacaataaatag

DBGET integrated database retrieval system