KEGG   Cynoglossus semilaevis (tongue sole): 103386117Help
Entry
103386117         CDS       T04866                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2-like
  KO
K05625  
transglutaminase 2 [EC:2.3.2.13]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     103386117
Cell adhesion molecules and their ligands [BR:csem04516]
 2. Integrin Family
  Beta1 integrins
   VLA-4
    ITGB1; integrin beta 1 [KO:K05719]
     103386117
   VLA-5
     103386117
   VLA-9
     103386117
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
11
AA seq 679 aa AA seqDB search
MAQVLDIDRCDLECDINNTDHRTDLNGVDRLILRRGQPFSISLYLRSGSFQPGVSKLDLT
AETGPQPSEQYGTRAVFGLSDSIDTSCWSAAVSSSPCGDTVALCICSAPDAPIGRYTLTL
GPSARIEFILLFNPWCAGDAVYLDDETSLEEYIMSQDGIIFRGDHNYTVPSPWNFGQFES
GILDVCLRILDMNPKYQRNPGKDCSGRRNPIYVSRVLSAMINCNDDKGVLLGNWKNDYEG
GVSPLSWRGSVEILRNWDAQSCEPVRYGQCWVFAAVACTVSRALGIPCRVITNYLSAHDT
NNNLVIERFVNEKGELMQSRDMVWNYHCWVESWMTRPDLKPGFNGWQASDPTPQEKSDGV
YCCGPVPVKAIKEGELTFNYDAVFVFAEVNADVLTFKKEKDGSTSRVTTTSLVGQKISTK
SVGSDAREDVTHLYKYPEGSDEERKAFKKANHQNKLHHQQLNQDQLITIKVSEDMRKGCD
FDVFAVVTNNTHSDKKYRLLLSACAVSYNGNLGGNCGYKDLLNVELSPGEGRKVPLRLNY
SKYSEQLTSDNAIRLAAMLWDYSSGKTTLAVRNIVLEDPQIKVTILGEPKVKRKLAAEIT
LKNPLPESLENCCFSIEGSNLTGGNIISERLNCSVGPGEDAKVKIYFTPTHSGLRKLVVD
FNSSKLCHVKGYRNVIIGK
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atggctcaagttctggacatcgatcgctgtgatctggagtgcgacatcaacaacaccgac
catcgcactgatctgaacggtgtagatcggttgatcctgagaagaggccaaccgttctcc
atcagcctgtatctgcgctctggcagcttccagccaggggtcagcaaactggacctgacc
gctgagacaggtcctcagccctctgaacagtatggcaccagagccgtatttggtctgtct
gacagcattgacacttcttgttggagtgctgcagtcagcagcagtccctgtggagacacg
gtggctctgtgcatctgctccgcccccgatgctcctataggccgctacaccctgaccctg
ggcccgtcagcacggatcgagttcatcctgctctttaacccttggtgtgcaggtgatgca
gtctacctggacgatgagaccagtttggaagaatacatcatgtctcaagatggaatcatc
tttcgtggcgatcacaattacacagtaccttctccctggaactttggccagtttgaaagt
gggatccttgatgtctgtctgaggattctggacatgaatccaaaatatcaaagaaaccca
ggtaaagactgctctggcaggaggaaccccatctatgtgtccagagttctaagtgctatg
atcaattgtaatgatgacaagggggtgttgctggggaattggaaaaatgattatgaagga
ggtgtgagccccctgtcctggagggggagtgtggagatcctgcgcaactgggatgcacaa
tcctgtgagcctgtgcgttacggacagtgctgggtgtttgccgcagtcgcctgcacagtt
tccagagctcttggcattccctgccgcgtgatcaccaactacctgtcagcccacgacacc
aacaataacctggtgattgaacggtttgtcaatgaaaagggagaactcatgcaatccaga
gacatggtctggaactatcactgctgggtggagagctggatgacccgacctgacctcaag
cctggctttaatggctggcaggccagtgacccaacaccccaggagaaaagtgatggagtg
tactgctgtggccccgtccctgtcaaagccatcaaggagggagagctcacgtttaattat
gacgcagtgtttgtctttgcggaggtcaacgcggatgtcctcaccttcaagaaggagaaa
gatgggagcacatcccgtgtcaccaccacttcactggtcggacaaaagatcagcaccaag
agtgtgggcagcgatgccagagaggatgtcacccatctgtacaaatatcctgaaggttct
gatgaggagcggaaggctttcaaaaaggccaaccaccaaaacaagctgcaccatcaacaa
ctgaatcaagatcagctcatcaccatcaaggtgtctgaagacatgaggaagggctgcgac
ttcgacgtgttcgccgtagttactaacaacacccacagtgacaagaagtaccgcctgttg
ttgagcgcctgcgctgtgtcctacaatggcaatctgggagggaactgtggatataaagat
cttctcaacgtggaactctccccaggagaagggagaaaggttccactcagactcaactat
tccaagtacagcgaacaactcacttcagacaatgcaattcgtttggctgccatgttgtgg
gactactccagtggaaagacaacacttgcagtgagaaatattgtgctggaagatccccaa
atcaaagtcacgatcctgggtgaaccaaaggtaaaacggaaacttgctgcagagattaca
ctgaaaaacccactgcctgagtctctggagaactgctgcttcagcatcgagggttccaac
ctgaccgggggaaacatcatctctgagagactgaactgctcagttggaccaggagaggac
gctaaggtgaagatttacttcactcccacccacagtggactgagaaagctggtggtcgac
ttcaacagcagcaagttatgtcacgtcaaaggctacagaaatgtaatcattggtaaatag

DBGET integrated database retrieval system