KEGG   Cylindrospermum stagnale: Cylst_5693Help
Entry
Cylst_5693        CDS       T02398                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csg  Cylindrospermum stagnale
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cylst_5693
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cylst_5693
   00680 Methane metabolism
    Cylst_5693
Enzymes [BR:csg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cylst_5693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
6395181..6398285
Genome map
AA seq 1034 aa AA seqDB search
MGSLLYSLSQAANIYPASELFLRHRLQVVEELWESVLRQECGQKMVELLRQLRDLCSPEG
QATHDQATSAVKLIEQLNINEAIRAARAFALYFQLINIIEQEYEQKQQLNRYSETEAEPA
DQETLPNIIYSTNQTEDDAPVNRGRGADLLTKSWMDKAQVKHKGTFAALFPHLFQLNVPP
QQIQRLITQLDVRLVFTAHPTEIVRHTIRDKQRQVVNLLQQLDVVENRSGSTGGGYPWEA
ADVREQLLEEIRLWWRTDELHQFKPTVLDEVDYALHYFQEVLFDGIPQLYKRFKYALNQT
FPWLEPPSKNFCSFGSWVGSDRDGNPSVTPEITWQTACYQRKMVLERYIRSVKQLIELLS
VSMHWSDVLPDLLESLELDQSTLSEVYDSLALRYRQEPYRLKLAYVLKRLENTRDRNLAL
SKRETPKNQDSPMYSSGSEFLAELRLIERNLTETGLSCRELENLICQVEIFDFNLTQLDI
RQESSRHADALNEILEYLQVLPQPYHDLTEAQRVTWLTGELQTRRPLIPAELPFSEKTND
VIETFRIVRSLQQEFGVKICQTYIISMCRDVSDVLEVLLLAKEARLFDPAIAVGSIQVVP
LFETVEDLQRSRRVMRQLFSLPLYRALLAGGYESTEQKVLSPESTNQSQSPQIGETIQAA
TSSVLRTDLQEVMLGYSDSNKDSGFLSSNWEIHKAQKSLQQIAEEYGVKLRIFHGRGGSV
GRGGGPAYEAILAQPGHSINGRIKITEQGEVLASKYSLEDLALYHMETITTAVIQASLLR
TGFDDIEPWNEIMEELAARSRQHYRALIYEQPDFTDFFHQVTPIEEISQLQISSRPARRP
SGKKDLSSLRAIPWVFSWTQTRFLLPSWYGIGTALQEFVNAEPEQHLKLLRYFYVKWPFF
KMVISKAEMTLAKVDMEMARHYVQELSNPEDRSRFDKVFEQIASEFYLTRDLVLQITGHN
RLLDGDPILQRSVQLRNGTIVPLGFIQVSLLKRLRQSQNTTTSGVIHSRYSKGELLRGAL
LTINGIAAGMRNTG
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atgggttcccttttatactcgttatcgcaagctgcaaatatctaccccgcctcggaatta
tttttgcgtcatcgtctacaggtagtagaggaattgtgggagtcggttctccggcaagaa
tgtggtcaaaagatggtggagctattgcggcagttgcgtgatttatgctcgccggaagga
caagccacacatgaccaagccacctccgccgttaaattgattgagcaactgaatatcaac
gaagcaattcgcgcagctcgtgcttttgctctgtattttcagctgattaatatcatagag
caggaatatgaacaaaagcagcaattgaatcgttattccgagacagaagcagaaccagcg
gatcaggaaactctaccgaatattatctactccactaaccaaacagaagacgatgcacct
gttaacaggggacgaggagcagacttgctcaccaagagttggatggacaaagcacaagtt
aaacacaaaggtacctttgcagccttgtttccccatttattccagttgaatgttccacca
cagcaaattcaacgtctaattacgcaattggatgtgcgcttagtattcaccgcacacccg
acagaaatcgttcgtcataccattcgagataagcagcgacaggtggtaaatctgttacaa
cagctagacgtggtggaaaaccgctctggcagcacaggtggcggctatccttgggaagca
gcagatgtccgcgaacaattgctcgaagaaattcgcctatggtggcgcacagacgaactc
caccaattcaaacccacggtgctggatgaagtagattatgccctccactacttccaagaa
gtgttatttgatggcattccccaactgtataaacgcttcaaatacgctctaaatcagacc
tttccttggctggaaccaccgagtaaaaacttctgctcttttggctcttgggtgggttct
gatcgagatggtaacccatcagtaacaccagaaatcacctggcagacagcttgctatcaa
agaaaaatggtgttggagagatatatccgctcagtcaagcagttgattgagttattgagt
gtgtcaatgcattggagtgatgtcctaccagacttgctggaatccttagagttagatcag
tctacattgagtgaagtttacgactctctagcattgcgttatcggcaagaaccttatcga
ctgaaactggcttatgtgctaaaacgtctggaaaatacacgtgatcgcaatctcgcttta
tctaagcgagaaacgccaaaaaatcaagactccccaatgtacagttcgggatcagagttt
ttagcagaactgcggttgattgaacgtaacttgaccgaaaccggtttaagttgtcgagag
ctagaaaatctgatctgtcaagtcgaaatttttgattttaacctcacacagctagatatc
cgccaggaatcatcccgccatgctgatgcgctgaatgaaattctcgaatacctccaagtc
ttaccccaaccttatcacgacctcacagaagcccaaagggttacttggctcacaggggaa
ctacaaacccgtcggccgttaattccagcggaattgccattttcggaaaaaaccaacgat
gtgattgaaaccttccgcatcgtgcgatcgctgcaacaagagtttggtgtcaaaatctgc
caaacttacattatcagtatgtgccgcgatgtgagcgatgttctagaggttttgttgtta
gctaaagaagccaggctttttgatcccgccattgctgtggggagtattcaggttgtacct
ctatttgagacggtagaagatttgcaacgctcccgacgcgtcatgcggcaactgttttca
ctaccgttatatcgtgccctgttggctggcggctatgagagtactgagcaaaaagtactg
agtcctgagtctaccaaccaaagtcagtcacctcaaatcggggaaactattcaagcagca
acttcttcagtactcaggactgacttacaagaagtgatgctagggtattctgacagcaac
aaagactctgggtttttaagtagcaactgggaaattcataaagcccaaaaatcactccag
caaatagcagaagagtatggcgtgaaactgcggattttccatggacgtggtggttccgtt
ggacgtggtggcggaccagcttatgaggcaattttggctcaaccaggtcacagtattaat
gggcggatcaagattaccgaacaaggggaagttttagcttctaaatactccttggaggac
ttggctttataccacatggaaactatcactaccgccgtgattcaagcgagtttactgcgg
actgggtttgatgatatcgaaccttggaatgagattatggaagagttagcagcgcgatct
cgtcaacattatcgcgctctcatttacgagcagcctgattttaccgactttttccaccaa
gtaaccccaattgaggaaattagccagctgcaaattagctcccgtccggcgcgtcgtcca
tctggtaagaaagatttaagcagtctgcgagctattccttgggtatttagctggacacaa
acccgatttttgctgccttcttggtatggtattggcacagctttacaagaattcgtcaac
gccgaaccagaacaacacctgaaattgttgcgctacttttatgtcaagtggcccttcttc
aaaatggtgatttccaaagcagaaatgaccttagccaaagtagatatggaaatggcacgc
cattacgtccaggaattgtctaaccccgaagatagatcccggtttgataaagttttcgag
caaattgcgagcgaattctatctcaccagggatttagtgttacaaatcactggacacaat
cgacttttagatggtgatccgatattgcagcgttcagtacagttacgcaacggcacaatt
gtacctttagggtttatccaagtttccctactcaaacgcttacggcaatcccagaacact
accacctctggggtgattcactcccgttatagcaaaggcgagttacttcgaggggcattg
ttaaccatcaacggcattgctgcgggtatgagaaatacaggttga

DBGET integrated database retrieval system