KEGG   Cronobacter sakazakii CMCC 45402: P262_00326Help
Entry
P262_00326        CDS       T02955                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
csi  Cronobacter sakazakii CMCC 45402
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    P262_00326
   00650 Butanoate metabolism
    P262_00326
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    P262_00326
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    P262_00326
Enzymes [BR:csi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     P262_00326
Amino acid related enzymes [BR:csi01007]
 Aminotransferase (transaminase)
  Class III
   P262_00326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
248021..249292
Genome map
AA seq 423 aa AA seqDB search
MRVKNSELNQRRQSATPRGVGVMCGFYAEKADNATLWDVEGNEIIDFAAGIAVLNTGHRH
PRVVEAIENQLRAFTHTAYQIVPYESYVALAERINACAPIDGPAKTAFFTTGAEAVENAV
KIARAYTRRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVFHAQYPNALHGVS
VDDAMASLERIFKADIAPDQVAAIVLEPVQGEGGFNVAPPAFMEALRALCDEHGILLIAD
EVQSGFARTGKLFAMEHYGVKPDLLTMAKSLAGGMPLSGVVGRAEVMDAPAPGGLGGTYA
GNPLAVAAAHAVLDVIEQENLCQRANELGQHLQEVLNQARTYCPAIAEVRGQGSMVAVEF
NDPQTGKPSPEFTQQVLTRAREEGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALEILSRA
LGR
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgaaaaattcagaattgaaccaacgtcgtcagagcgccaccccacgtggcgtc
ggcgtcatgtgcggcttctatgccgaaaaagccgacaacgccaccctgtgggacgtggaa
ggcaacgagattatcgacttcgcggcggggatcgcggtgctgaacaccggccatcgtcac
ccgcgcgtggtggaggccattgaaaaccagctgcgcgcctttacacacacggcgtaccag
atagtcccttacgaaagctatgtggcgcttgcggagcgcatcaacgcctgcgcgccgatt
gacggcccggcgaagaccgcgttcttcaccaccggcgcggaagcggtggaaaacgccgtg
aaaatcgcgcgcgcgtatacccgtcgcccaggcttgatcaccttcggcggcggcttccac
gggcgcacgtttatgacgatggcgctcaccggcaaagtggcaccgtacaaaatcggcttc
ggcccgttccctggctcggtgttccacgcgcaatacccgaacgcgttgcacggcgtgtcg
gtggacgatgcgatggcaagccttgagcgtatttttaaagccgatatcgcaccggatcag
gtggcggccattgtgctggagccagtgcagggcgaaggcggttttaatgtcgcgccgcca
gcgtttatggaggccctgcgcgcgctgtgcgacgagcacggcattctgctgattgccgat
gaagtgcagagcggctttgcgcgcaccggcaaactgttcgcgatggagcattacggcgtg
aagccggatctgctgacgatggcgaaaagcctcgcgggcgggatgccgctctcgggcgtg
gtcgggcgcgcggaagtgatggacgcgcctgcgccgggcggccttggcggcacctacgcc
ggtaacccgctggcggttgcggcagcgcacgcggtgctggatgtgattgagcaggaaaat
ctctgccagcgcgcgaacgagctgggccagcatctgcaagaggtgctcaaccaggcgcgg
acgtactgcccggcgattgccgaagtccgcgggcagggctcgatggtggcggtggagttt
aacgatccgcagaccggcaagccgtcgcctgaatttacgcagcaggtgctgacgcgcgcc
cgtgaagaggggctgctgctgctgagctgcggcgtttacggcaacgttatccgtttcctt
tatccgctgaccatcccggatgcgcagttcagcaaggcgctggagatcctctcccgcgcg
ctggggcgctaa

DBGET integrated database retrieval system